Entry information : CsuCcP
Entry ID 10675
Creation 2012-03-05 (Christophe Dunand)
Last sequence changes 2012-03-05 (Christophe Dunand)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2016-12-22 (Marcel Zamocky)
Peroxidase information: CsuCcP
Name CsuCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Ceriporiopsis
Organism Ceriporiopsis subvermispora    [TaxId: 42742 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsuCcP
start..stop
S start..stop
WcoCcP 596 0 1..378 1..372
TcamCcP 586 0 1..378 1..372
LsulCcP01 585 0 1..377 1..372
FpinCcP 578 0 1..372 1..371
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1561632..1561943 312 N° 2 1561521..1561575 55 N° 3 1561381..1561462 82 N° 4 1561053..1561323 271
N° 5 1560975..1560991 17 N° 6 1560702..1560917 216 N° 7 1560565..1560648 84 N° 8 1560404..1560503 100
complement(join(1560404..1560503,1560565..1560648,1560702..1560917,1560975..1560 991,1561053..1561323,1561381..1561462,1561521..1561575,1561632..1561943))


exon

Literature and cross-references CsuCcP
DNA ref. JGI genome:   scaffold_6 (1561943..1560404)
Cluster/Prediction ref. JGI gene:   83438
Protein sequence: CsuCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   379
PWM (Da):   %s   42129  
PI (pH):   %s   8.69
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFSVLRTSFRRAAVPPAAARTSKAFRSPAFRKYSTEVPKPEGAGKSNAALFAGLGLAVVGGVGFWIYSSDSNKAKEAGTAVRSGVQSAKAAANFTPTKEDYQKVYDRIVEILDEASDADYDDGSYGPVVLRLAWHASGTYDKDTNTGGSNYATMRFEPEALHGANAGLNVARTLMEKVKKEFPWISYGDLWTLGGVCAIQELGGPKIPWRPGRIDGFQEQCTPDGRLPDATQGAQHLRIFYRMGFNDREIVALSGAHALGRCHTDRSGFDGPWTFSPITVSNEYFRLLFDEKWVWRKWNGPKQLQDAKSKTLMMLPTDYVLVQDKSFRKFAEQYARDQDLWFKDFANSVSRLFELGVPTSQWVSSEQWIMKSSDEN

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTCTCTGTTCTGAGAACTTCGTTCCGCAGGGCAGCTGTCCCTCCGGCTGCTGCAAGGACTTCCAAGGCGTTCAGAAGCCCGGCCTTTCGCAAGTACTCGACCGAGGTCCCCAAG
CCCGAAGGCGCGGGCAAGTCCAATGCCGCCCTTTTCGCTGGCCTCGGTCTCGCTGTCGTCGGCGGAGTTGGCTTTTGGATCTACTCCTCAGACTCCAACAAGGCCAAGGAGGCTGGCACC
GCTGTGAGGTCAGGCGTCCAGTCGGCCAAGGCTGCCGCCAACTTCACTCCCACCAAGGAGGACTATCAAAAG
GTCTGTCTCCATTCGTCAGCGCAATACCGCGTCCATTTTAATTACCTT
CACCCCAGGTGTACGACAGGATCGTCGAGATCCTTGATGAGGCCTCGGACGCTGACTATGACGGTAAGTCGAATAGTAAGCCCCTCATCTCTATTACTGCGACTCACGCGATGCGCTGTA
GACGGCTCGTATGGTCCTGTGGTCCTCCGTCTTGCATGGCACGCTTCCGGAACATACGACAAGGACACCAACACCGGCGGAAGGTACGTGGAAATGACTCGATGATATCCTTATCGCTAG
TTGACGCCCGCTCTTGACAGCAACTACGCTACGATGCGCTTCGAACCCGAGGCGCTCCACGGTGCAAACGCTGGCCTTAACGTTGCTCGCACGTTGATGGAAAAGGTCAAGAAGGAATTT
CCTTGGATCTCGTACGGCGACTTGTGGACTCTTGGTGGAGTTTGCGCCATCCAGGAGCTGGGCGGCCCCAAGATCCCGTGGAGGCCTGGCCGCATCGATGGATTCCAGGAACAGTGCACT
CCCGACGGCCGTCTCCCTGACGCAACCCAAGGCGCTCAGCACCTCCGGAAC
GTGAGTATTCGCAGTGAACGACCTAAATGACCGCTAATAAACACACCTCGACTCCTTGCAGATCTTCTA
CCGCATGGG
GTACGTGTCATCATAATAAAATTAATAGCTCGAGACGAGATGTTGACATATCATCAGTTTCAACGATCGTGAAATCGTGGCACTCTCTGGTGCGCACGCTCTCGGCCGCTG
CCACACCGACCGCTCTGGATTCGATGGCCCCTGGACCTTCTCGCCTATAACCGTCAGCAACGAGTACTTCCGTCTCCTCTTCGACGAGAAGTGGGTATGGAGGAAGTGGAACGGCCCCAA
GCAGCTCCAGGACGCTAAGAGCAAGACTCTTATGATGCTTCC
GTATGTCACTTGCTTTCTTTTGGAGTGCGACGTTTCTTGACCCACGCGTGCAGTACGGACTACGTGCTCGTCCAGGAC
AAGAGCTTCAGGAAGTTCGCTGAGCAGTACGCCCGCGACCAGGACCTGTGGTTCAAGGA
GTAAGTACCTTGTTGTCTGTGGGTAAGATGAGTGTGCTTACGTGATACTTCCCCCGTGCAG

TTTTGCCAACTCTGTCTCACGCCTGTTTGAGCTTGGTGTTCCGACTTCGCAGTGGGTCAGCTCGGAGCAGTGGATCATGAAGAGCTCCGACGAGAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTCTCTGTTCTGAGAACTTCGTTCCGCAGGGCAGCTGTCCCTCCGGCTGCTGCAAGGACTTCCAAGGCGTTCAGAAGCCCGGCCTTTCGCAAGTACTCGACCGAGGTCCCCAAG
CCCGAAGGCGCGGGCAAGTCCAATGCCGCCCTTTTCGCTGGCCTCGGTCTCGCTGTCGTCGGCGGAGTTGGCTTTTGGATCTACTCCTCAGACTCCAACAAGGCCAAGGAGGCTGGCACC
GCTGTGAGGTCAGGCGTCCAGTCGGCCAAGGCTGCCGCCAACTTCACTCCCACCAAGGAGGACTATCAAAAG
GTGTACGACAGGATCGTCGAGATCCTTGATGAGGCCTCGGACGCTGAC
TATGACG
ACGGCTCGTATGGTCCTGTGGTCCTCCGTCTTGCATGGCACGCTTCCGGAACATACGACAAGGACACCAACACCGGCGGAAGCAACTACGCTACGATGCGCTTCGAACCCGAG
GCGCTCCACGGTGCAAACGCTGGCCTTAACGTTGCTCGCACGTTGATGGAAAAGGTCAAGAAGGAATTTCCTTGGATCTCGTACGGCGACTTGTGGACTCTTGGTGGAGTTTGCGCCATC
CAGGAGCTGGGCGGCCCCAAGATCCCGTGGAGGCCTGGCCGCATCGATGGATTCCAGGAACAGTGCACTCCCGACGGCCGTCTCCCTGACGCAACCCAAGGCGCTCAGCACCTCCGGAAC
ATCTTCTACCGCATGGGTTTCAACGATCGTGAAATCGTGGCACTCTCTGGTGCGCACGCTCTCGGCCGCTGCCACACCGACCGCTCTGGATTCGATGGCCCCTGGACCTTCTCGCCTATA
ACCGTCAGCAACGAGTACTTCCGTCTCCTCTTCGACGAGAAGTGGGTATGGAGGAAGTGGAACGGCCCCAAGCAGCTCCAGGACGCTAAGAGCAAGACTCTTATGATGCTTCC
TACGGAC
TACGTGCTCGTCCAGGACAAGAGCTTCAGGAAGTTCGCTGAGCAGTACGCCCGCGACCAGGACCTGTGGTTCAAGGA
TTTTGCCAACTCTGTCTCACGCCTGTTTGAGCTTGGTGTTCCG
ACTTCGCAGTGGGTCAGCTCGGAGCAGTGGATCATGAAGAGCTCCGACGAGAACTAG

Retrieve as FASTA