Entry information : GmarCcP
Entry ID 10681
Creation 2012-03-05 (Christophe Dunand)
Last sequence changes 2012-03-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarCcP
Name GmarCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarCcP
start..stop
S start..stop
HsubCcP 615 0 1..381 1..377
HcyCcP 587 0 1..374 1..376
AthiCcP01 570 0 1..379 1..371
ScomCcP 563 0 2..379 4..377
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 222948..223262 315 N° 2 222844..222892 49 N° 3 222705..222786 82 N° 4 222491..222644 154
N° 5 222300..222433 134 N° 6 222031..222246 216 N° 7 221876..221959 84 N° 8 221685..221820 136
complement(join(221685..221820,221876..221959,222031..222246,222300..222433,2224 91..222644,222705..222786,222844..222892,222948..223262))


exon

Literature and cross-references GmarCcP
DNA ref. JGI genome:   scaffold_48 (223262..221685)
Cluster/Prediction ref. JGI gene:   1356136
Protein sequence: GmarCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   390
PWM (Da):   %s   43435.64  
PI (pH):   %s   7.6
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFSVFRAPLCRAGASPLRRVAQLPKATFRSNFNRKFSTPPPPPPASEAKSSSNTGLFVGIGVAVAGAVAYYFYNTSEANNSIKSGLQVAKVKANFVPSKEDYIKVYNRIAEVIDDAGEYDDGSYGPVVFRLAWHSSGTYDKATNTGGSNYATMRFETEAQHPANAGLDVARTLMEKVKQEYPWISYGDLWTLGGVAAIEMAGPKVPWRPGRIDGEATEATPDGRLPDASQGADHLRNIFYRMGFNDQEIVALSGAHALGRCHRDRSGFDGPWTFAPTTVTNDYFRLLFDDKWVWKRWDGPKQLEDKKTRSLMMLPTDYVLVQDKSFKKFAKSYADNQDLWFKDFSNSVARLFELGVPTQQFVAPEPWIMPTVDEQKDAKDQKAEENK

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCAGCGTCTTCCGCGCTCCTCTCTGCAGGGCAGGGGCCAGCCCTCTGCGCAGGGTTGCCCAACTGCCCAAGGCCACATTCCGCTCGAATTTCAACCGCAAGTTCTCGACCCCA
CCGCCGCCGCCACCCGCGTCCGAGGCCAAGTCGTCGTCTAACACTGGGCTCTTCGTCGGCATTGGAGTTGCGGTTGCTGGAGCTGTGGCTTATTACTTCTACAACACTAGCGAGGCCAAC
AACTCGATCAAGTCGGGTCTGCAGGTCGCGAAAGTCAAAGCAAATTTCGTGCCGAGCAAGGAGGATTACATCAAG
GTGCTTTTTTTACTGTTGTAACTTCTGAGCCTTTGCTTATCGGAT
GGATCATTAGGTTTACAACAGGATCGCTGAAGTCATCGACGACGCTGGCGAATACGATGGTGTGTTTGGATAACGCGCCGACCCTTGAATCCAATCGCTGATGACCAGCCTTTCAGACGG
CTCGTATGGACCAGTCGTCTTCCGTCTTGCTTGGCACTCGTCCGGTACATACGATAAGGCGACCAACACTGGTGGCAG
GTGCGCACTGCCTGTCTCTGTGTTGTAGAATATAAGCTGATT
CGAATGAATTTACGACAGCAACTACGCGACGATGCGTTTCGAAACTGAGGCTCAGCACCCCGCAAACGCAGGTCTGGACGTTGCTCGCACGCTCATGGAGAAAGTGAAGCAGGAATATCC
TTGGATTAGCTATGGTGACCTCTGGACTCTTGGTGGTGTTGCTGCCATTCAG
GTTCGTAAATTCCGGTTCCGTATGACACGATTATAAAACGGGGATCTACTGCTGTAGGAAATGGCCGG
CCCCAAGGTTCCCTGGCGCCCAGGACGTATCGATGGTGAGGCTACTGAAGCTACTCCCGACGGCCGTCTTCCCGATGCCAGCCAAGGCGCTGATCATCTGAGGAACATCTTTTACCGTAT
GGG
GTGGGTGATGATTTGTTTTCCTCCCTTTGTAGTGCTAACGGTCAGCCTTTTAGTTTCAACGACCAGGAAATTGTAGCCCTCTCTGGCGCTCATGCTCTCGGACGATGCCACCGTGAT
CGCTCTGGATTTGACGGCCCTTGGACTTTTGCCCCTACCACGGTCACCAACGATTACTTCCGACTTCTCTTTGATGACAAGTGGGTCTGGAAACGCTGGGATGGACCCAAGCAACTCGAG
GACAAGAAGACCCGCAGCTTGATGATGTTACC
GTACGTCCCCTCTTGACTTTGATCGTTGACTCGGTGCTCGGTAATTCTAATAACTCTGTTTCAACCCCCAGTACCGATTACGTGCTCG
TCCAAGACAAGTCCTTCAAGAAGTTCGCCAAGTCTTACGCTGATAACCAGGATCTATGGTTCAAGGA
GTGCGTTTCTCTTCTTTTCATCTCTGCAATTGCGCGATTAAACCCACCGCAAC
AGTTTCTCCAATTCTGTCGCCCGACTTTTCGAGCTTGGTGTGCCGACGCAGCAGTTCGTTGCCCCTGAGCCGTGGATCATGCCCACTGTTGACGAGCAGAAGGATGCTAAAGACCAGAAG
GCGGAGGAAAATAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCAGCGTCTTCCGCGCTCCTCTCTGCAGGGCAGGGGCCAGCCCTCTGCGCAGGGTTGCCCAACTGCCCAAGGCCACATTCCGCTCGAATTTCAACCGCAAGTTCTCGACCCCA
CCGCCGCCGCCACCCGCGTCCGAGGCCAAGTCGTCGTCTAACACTGGGCTCTTCGTCGGCATTGGAGTTGCGGTTGCTGGAGCTGTGGCTTATTACTTCTACAACACTAGCGAGGCCAAC
AACTCGATCAAGTCGGGTCTGCAGGTCGCGAAAGTCAAAGCAAATTTCGTGCCGAGCAAGGAGGATTACATCAAG
GTTTACAACAGGATCGCTGAAGTCATCGACGACGCTGGCGAATAC
GATG
ACGGCTCGTATGGACCAGTCGTCTTCCGTCTTGCTTGGCACTCGTCCGGTACATACGATAAGGCGACCAACACTGGTGGCAGCAACTACGCGACGATGCGTTTCGAAACTGAGGCT
CAGCACCCCGCAAACGCAGGTCTGGACGTTGCTCGCACGCTCATGGAGAAAGTGAAGCAGGAATATCCTTGGATTAGCTATGGTGACCTCTGGACTCTTGGTGGTGTTGCTGCCATTCAG
GAAATGGCCGGCCCCAAGGTTCCCTGGCGCCCAGGACGTATCGATGGTGAGGCTACTGAAGCTACTCCCGACGGCCGTCTTCCCGATGCCAGCCAAGGCGCTGATCATCTGAGGAACATC
TTTTACCGTATGGG
TTTCAACGACCAGGAAATTGTAGCCCTCTCTGGCGCTCATGCTCTCGGACGATGCCACCGTGATCGCTCTGGATTTGACGGCCCTTGGACTTTTGCCCCTACCACG
GTCACCAACGATTACTTCCGACTTCTCTTTGATGACAAGTGGGTCTGGAAACGCTGGGATGGACCCAAGCAACTCGAGGACAAGAAGACCCGCAGCTTGATGATGTTACC
TACCGATTAC
GTGCTCGTCCAAGACAAGTCCTTCAAGAAGTTCGCCAAGTCTTACGCTGATAACCAGGATCTATGGTTCAAGGA
TTTCTCCAATTCTGTCGCCCGACTTTTCGAGCTTGGTGTGCCGACG
CAGCAGTTCGTTGCCCCTGAGCCGTGGATCATGCCCACTGTTGACGAGCAGAAGGATGCTAAAGACCAGAAGGCGGAGGAAAATAAATAA

Retrieve as FASTA