Entry information : WcoCcP
Entry ID 10682
Creation 2012-03-05 (Christophe Dunand)
Last sequence changes 2012-03-05 (Christophe Dunand)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2016-12-22 (Marcel Zamocky)
Peroxidase information: WcoCcP
Name WcoCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Wolfiporia
Organism Wolfiporia cocos    [TaxId: 81056 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value WcoCcP
start..stop
S start..stop
TcamCcP 628 0 1..372 1..372
PplCcP01-1A 625 0 1..372 1..373
LsulCcP01 614 0 1..372 1..373
FpinCcP 613 0 1..366 1..371
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1255407..1255700 294 N° 2 1255287..1255341 55 N° 3 1255153..1255234 82 N° 4 1254832..1255102 271
N° 5 1254751..1254767 17 N° 6 1254483..1254698 216 N° 7 1254345..1254428 84 N° 8 1254189..1254288 100
complement(join(1254189..1254288,1254345..1254428,1254483..1254698,1254751..1254 767,1254832..1255102,1255153..1255234,1255287..1255341,1255407..1255700))


exon

Literature and cross-references WcoCcP
DNA ref. JGI genome:   scaffold_13 (1255700..1254189)
Cluster/Prediction ref. JGI gene:   140202
Protein sequence: WcoCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   373
PWM (Da):   %s   41221.54  
PI (pH):   %s   8.54
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFLALRASLRKAPLSAARASRALRTPTFRKYSTEVPPQKSNTALFAGLGAAAVGGIAFYVYTSNSNAAKEAGTAVRSGVQSAKAAANFVPSKEDYQKVYNRIAEVMDEAADKDYDDGSYGPVFLRLAWHSSGTYDKESGTGGSNYATMRFEPESLHGANAGLHVAREVMEGIKKEYPWISYGDLWTLGGVCAIQEMGGPKIPWRPGRIDGFAAQVTPDGRLPDGAQGAAHLRNIFYRMGFNDQEIVALSGAHALGRCHRDRSGFDGPWTFSPVTVSNEYYRLLLEEKWVWRKWDGPKQLQDKNSKSLMMLPSDYALIQDKSMKKWVDAYAKDQDLWFNDFSDVISRLFELGVPTSQFVSSDKWVIKSTDEQ*

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCTTAGCTCTGCGAGCTTCCCTTCGCAAGGCTCCGTTGTCAGCTGCCAGGGCATCGCGGGCCCTGAGAACCCCAACTTTCAGAAAATATTCCACCGAAGTACCGCCACAGAAG
TCAAACACCGCTCTCTTCGCCGGGCTGGGAGCGGCCGCCGTCGGTGGCATTGCATTCTATGTATACACCTCTAACTCGAACGCTGCTAAAGAGGCTGGCACGGCGGTGAGGTCCGGCGTG
CAGTCGGCTAAGGCCGCCGCAAACTTTGTCCCTTCCAAAGAAGACTATCAGAAG
GTTAGACTCCGTCCGCAAGTTTCCTGTTGAATCTGCGTTGATTCGCGCGAAATACCCGCATATAGG
TTTACAACAGGATCGCCGAGGTTATGGATGAAGCAGCGGACAAGGATTACGATG
GTATGTGCGGATCTCGATTGGACGGGATGAGGTACTGACGTCCACTTCGCAGATGGCTCCTACGGC
CCTGTCTTTCTTCGATTGGCATGGCACTCGTCTGGAACATACGATAAGGAGTCTGGCACCGGTGGAAG
GTACGTCATAGGATCGAGCGGTTAATTGCGGATTTGACCGATCTGTGCAGCA
ACTATGCCACTATGCGGTTCGAACCAGAGTCTCTGCACGGTGCTAACGCTGGCTTGCACGTTGCGCGTGAAGTTATGGAAGGCATCAAAAAGGAATACCCCTGGATCTCGTACGGTGACT
TGTGGACTCTCGGTGGTGTTTGCGCTATTCAGGAGATGGGCGGCCCCAAGATACCTTGGAGGCCCGGTCGCATTGACGGTTTCGCGGCACAAGTCACTCCTGATGGCCGACTTCCCGACG
GTGCTCAGGGCGCAGCTCACCTGAGGAAC
GTAAGTAATGATCCTCTGCATGTTCCTTGAGGAGCTGGACTCATCTATTCCTTGAATACCCCAGATTTTCTACCGCATGGGGTGAGCTTGA
TCTTTTAAGCGATAAACCAGGCCCTTCTCTAACGTTTGTCAGATTCAATGACCAGGAAATCGTCGCGCTTTCGGGTGCTCACGCTCTTGGACGCTGCCACCGCGACCGCTCTGGATTTGA
TGGCCCTTGGACCTTCTCCCCTGTCACTGTCAGTAACGAATACTACCGTCTCCTCTTGGAAGAGAAGTGGGTCTGGAGGAAGTGGGATGGCCCCAAGCAGCTGCAGGACAAGAACTCAAA
GTCGCTAATGATGCTTCC
GTAAGTCCCTGTGATTCATGAAAAGTATCAACGACGCTGATCCTCATCATTCAGCTCGGATTATGCACTCATCCAGGACAAATCGATGAAGAAGTGGGTTGA
TGCATACGCAAAGGACCAGGACTTGTGGTTCAACGA
GTACGTGTTTCACAGTCGCCTAGATGCCACGGTCATACTGACGATCTGCCGTACAGCTTCTCCGATGTCATCTCTCGCCTGTTC
GAGCTCGGCGTGCCCACTTCGCAGTTTGTCTCCTCTGACAAGTGGGTCATAAAGAGCACTGATGAGCAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCTTAGCTCTGCGAGCTTCCCTTCGCAAGGCTCCGTTGTCAGCTGCCAGGGCATCGCGGGCCCTGAGAACCCCAACTTTCAGAAAATATTCCACCGAAGTACCGCCACAGAAG
TCAAACACCGCTCTCTTCGCCGGGCTGGGAGCGGCCGCCGTCGGTGGCATTGCATTCTATGTATACACCTCTAACTCGAACGCTGCTAAAGAGGCTGGCACGGCGGTGAGGTCCGGCGTG
CAGTCGGCTAAGGCCGCCGCAAACTTTGTCCCTTCCAAAGAAGACTATCAGAAG
GTTTACAACAGGATCGCCGAGGTTATGGATGAAGCAGCGGACAAGGATTACGATGATGGCTCCTAC
GGCCCTGTCTTTCTTCGATTGGCATGGCACTCGTCTGGAACATACGATAAGGAGTCTGGCACCGGTGGAAG
CAACTATGCCACTATGCGGTTCGAACCAGAGTCTCTGCACGGTGCTAAC
GCTGGCTTGCACGTTGCGCGTGAAGTTATGGAAGGCATCAAAAAGGAATACCCCTGGATCTCGTACGGTGACTTGTGGACTCTCGGTGGTGTTTGCGCTATTCAGGAGATGGGCGGCCCC
AAGATACCTTGGAGGCCCGGTCGCATTGACGGTTTCGCGGCACAAGTCACTCCTGATGGCCGACTTCCCGACGGTGCTCAGGGCGCAGCTCACCTGAGGAAC
ATTTTCTACCGCATGGGA
TTCAATGACCAGGAAATCGTCGCGCTTTCGGGTGCTCACGCTCTTGGACGCTGCCACCGCGACCGCTCTGGATTTGATGGCCCTTGGACCTTCTCCCCTGTCACTGTCAGTAACGAATAC
TACCGTCTCCTCTTGGAAGAGAAGTGGGTCTGGAGGAAGTGGGATGGCCCCAAGCAGCTGCAGGACAAGAACTCAAAGTCGCTAATGATGCTTCC
CTCGGATTATGCACTCATCCAGGAC
AAATCGATGAAGAAGTGGGTTGATGCATACGCAAAGGACCAGGACTTGTGGTTCAACGA
CTTCTCCGATGTCATCTCTCGCCTGTTCGAGCTCGGCGTGCCCACTTCGCAGTTTGTCTCC
TCTGACAAGTGGGTCATAAAGAGCACTGATGAGCAGTAG

Retrieve as FASTA