Entry information : TmesCcP02
Entry ID 10684
Creation 2012-03-05 (Christophe Dunand)
Last sequence changes 2012-03-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: TmesCcP02
Name TmesCcP02
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Tremella
Organism Tremella mesenterica    [TaxId: 5217 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TmesCcP02
start..stop
S start..stop
DcryCcP02 539 0 3..317 1..315
DcryCcP01 532 0 3..317 1..312
CnCcP02_R265 504 0 3..308 1..308
CnCcP02_grubiiH99 503 0 3..317 1..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 818647..818683 37 N° 2 818814..818889 76 N° 3 819173..819212 40 N° 4 819254..819273 20
N° 5 819316..819340 25 N° 6 819423..819519 97 N° 7 819585..819775 191 N° 8 820044..820111 68
N° 9 820156..820251 96 N° 10 820430..820478 49 N° 11 820549..820654 106 N° 12 820795..820943 149
join(818647..818683,818814..818889,819173..819212,819254..819273,819316..819340, 819423..819519,819585..819775,820044..820111,820156..820251,820430..820478,82054 9..820654,820795..820943)


exon

Literature and cross-references TmesCcP02
DNA ref. JGI genome:   scaffold_11 (818647..820943)
Cluster/Prediction ref. JGI gene:   33689
Protein sequence: TmesCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318
PWM (Da):   %s   34670.4  
PI (pH):   %s   6.73
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSIQSIKEGDYEGIRGEIRKVLKQPQYDDGSAGPVFVRLAWHASGNFSLVEHNGGSNGAGMRFAPESTDPANAGLTHAIDFLMPIQAANPWISHSDLWTLAGITAVEAAGGPRVPWQPGRTDYTSAAAAEEHRGQVGDRLPDGAKGADHIREVFSRMGFTDQEIVALSGAHALGRCHPDRSGFDGPWVVNPTRFSNQYYKLLLTRKWVPRQWDGPFQYETTVAGTKLMMLPTDMALIEDEKFRPWVEKYAKDQDLFFKDFALAFGKLLELGVDRDDTGFAKLVKKAAEEGKPLDKVKMAGGGCPFAGTGPKGRDAKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (11 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTATACAATCCATCAAAGAAGGTGACTACGAAGGTCAGTCATAACTATCTACCTCTCCGCAATCCCCATGGCCCTATAACTCCCTCTTGGGTCCAACGCACTAGGTCTGTACATTG
ACAACCTTGAGATCGGAACTTCGACCGGGGATGATATTGATATTCAGGTATCAGAGGTGAAATACGTAAAGTACTTAAACAACCTCAGTATGATGATGGTTCTGCAGGACCTGTCTTTGT
GAG
GTATGTCACATTCTTCATTTTACACTTCTTCGATTCATATCTCCGATCTCATGTATACCTAGCGAATATCACTCATTTTTGAGCTAGCCTTATGCACGTCGTGGTGGTAGATCACAC
AACTTATCTCTACTTTGTCCATGTCTATATCATACAGGTTGGAGTATTTCAGCAGTACTTTGTGCCCCTATACTGCACGGTGATGACGGATTGGAACACTTACCACGACCACTTTGTATT
CACTTACTAGACCATAGTATCATAATGAAACAACTCTGACGCTCAGACTTGCTTGGCACGCATCTGGAAATTTCAGCTTAGTGGAGGTAAGTACCCTTTCTGGACCGAGGTGAGGCTGAT
GGGTAAGCATAATGGTGGATCTAACGGGTTGGTTTCACACTTGATTGAGGAAATGAGCTGATTTGTAAGAGCGGGAATGAGATTTGCTCCTGAAGTAGGTTAATCTCATTATTCTTCTCA
CTTATACTCGATTGATTTTCAAGATGAAGCAATTAGAAACATGCTGATGGATCAAGTCGACTGATCCTGCCAATGCTGGATTAACTCATGCTATCGATTTCTTGATGCCTATACAAGCTG
CCAACCCATGGATATCACATTCGGATTTATGGA
GTGAGTCTGTTATCCCCCCCCCTTTTCCACACTATTTCTCCTCTGGAGTCCGTCCCTGATCCCAGCACTGGCAGGTATCACAGCCGT
CGAAGCTGCCGGTGGACCTCGAGTACCCTGGCAACCAGGTCGGACGGATTACACTTCTGCCGCTGCTGCCGAGGAGCATCGAGGGCAAGTGGGGGATCGGTTGCCGGACGGGGCGAAGGG
AGCGGATCATATTAGAGAAGTGTTTAGTAGAATGGGATTCACAGATCAG
GTGGGTGAATTTAACGTTTGTTGTCAAATTTACTCGTACTTCTCCTACGGCATTCATGTCCCGGATAGGAC
AGTGCGTTGCCTATTGACGAGATGCTGCTGAGCGTTGTCATGAGGAGCATCTCGATTTCCTGTCTCAAGCCGTCAAAGCAAAGGACGAGTATGTGTCTTTTTGTTTATCATAGTGAAGGG
GACTCCAAGATGTACATGGAGGAGGACGATGACGCGCTTTAGCGAGGAGCACTGTATAGGAGATGACTGATATGTAGGAAATCGTCGCTTTATCAGGCGCTCACGCCTTGGGGAGATGTC
ATCCCGATAGATCGGGGTTTGATGG
GTCAGTCGTCGCATCACGATATATCAAGGCAAGCTGAGAAATAGTCCATGGGTCGTCAACCCCACTCGGTTCTCGAATCAATATTACAAGCTCTT
GTTAACTCGGAAATGGGTACCGAGACAGTGGGACGGGCCATTCCA
GTGAGTCACCCATGTTCTTTTCTCTCTTTCCTCTCTTTGACTTCTCCTTGTACCCTCGTGGTCTTCGCTAGACAC
CCTGCTCTACCATCTTGCGATTGAGCCCGCAAGATTATCATCTCACCTTCACTTGTCATCTGTCCTCAATGCTCCTGGGTTTGTGAATTGACATTGATGATAGATACGAAACTACCGTGG
CGGGTACCAAACTGATGATGCTTCCTACCGAT
GTGAGTTATTCAATTCTGATCTTCATCAACTCTTGGCCTAATTCTGAGAGGTCGATCGAACTGAGATTAGATGGCTTTGATAGAAGAT
GAAAAGTTTCGTCCATGGGTTGAGAAATACGCAAAGGATCAAGATTTGTTTTTCAAAGATTTCGCTTTGGCATTTGGAAAGTTGCTCG
GTGAGTTGATCCATGAGATCTTCTTAACCAGC
CTTTACTCTAAACATTCACCACTCCATTTTGACCTGAGACTTTATTTCCCTTACCAATGTTTCAATGATGTGATTGTGGAAGAAGGGAAAGAGCTATGCTGATGATAGAACTCGGTGTTG
ATCGAGATGATACTGGTTTCGCTAAACTTGTAAAGAAAGCTGCAGAAGAGGGGAAACCTTTGGATAAGGTGAAAATGGCCGGTGGGGGTTGTCCCTTCGCTGGGACTGGTCCAAAAGGGA
GAGATGCGAAGTTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTATACAATCCATCAAAGAAGGTGACTACGAAGGTATCAGAGGTGAAATACGTAAAGTACTTAAACAACCTCAGTATGATGATGGTTCTGCAGGACCTGTCTTTGTGAGACTTGCT
TGGCACGCATCTGGAAATTTCAGCTTAGTGGAG
CATAATGGTGGATCTAACGGAGCGGGAATGAGATTTGCTCCTGAATCGACTGATCCTGCCAATGCTGGATTAACTCATGCTATCGAT
TTCTTGATGCCTATACAAGCTGCCAACCCATGGATATCACATTCGGATTTATGGA
CACTGGCAGGTATCACAGCCGTCGAAGCTGCCGGTGGACCTCGAGTACCCTGGCAACCAGGTCGG
ACGGATTACACTTCTGCCGCTGCTGCCGAGGAGCATCGAGGGCAAGTGGGGGATCGGTTGCCGGACGGGGCGAAGGGAGCGGATCATATTAGAGAAGTGTTTAGTAGAATGGGATTCACA
GATCAG
GAAATCGTCGCTTTATCAGGCGCTCACGCCTTGGGGAGATGTCATCCCGATAGATCGGGGTTTGATGGTCCATGGGTCGTCAACCCCACTCGGTTCTCGAATCAATATTACAAG
CTCTTGTTAACTCGGAAATGGGTACCGAGACAGTGGGACGGGCCATTCCA
ATACGAAACTACCGTGGCGGGTACCAAACTGATGATGCTTCCTACCGATATGGCTTTGATAGAAGATGAA
AAGTTTCGTCCATGGGTTGAGAAATACGCAAAGGATCAAGATTTGTTTTTCAAAGATTTCGCTTTGGCATTTGGAAAGTTGCTCG
AACTCGGTGTTGATCGAGATGATACTGGTTTCGCT
AAACTTGTAAAGAAAGCTGCAGAAGAGGGGAAACCTTTGGATAAGGTGAAAATGGCCGGTGGGGGTTGTCCCTTCGCTGGGACTGGTCCAAAAGGGAGAGATGCGAAGTTGTAG

Retrieve as FASTA