Entry information : TmesCcP01 (CCP1)
Entry ID 10685
Creation 2012-03-05 (Christophe Dunand)
Last sequence changes 2012-03-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: TmesCcP01 (CCP1)
Name (synonym) TmesCcP01 (CCP1)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Tremella
Organism Tremella mesenterica    [TaxId: 5217 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TmesCcP01
start..stop
S start..stop
CnCcP01_JEC21 601 0 1..373 1..376
CnCcP01_grubiiH99 582 0 1..373 1..376
CgaCcP 568 0 1..373 1..376
CgaCcP01_R265 557 0 1..373 1..375
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5870403..5870513 111 N° 2 5870043..5870295 253 N° 3 5869748..5869887 140 N° 4 5869446..5869675 230
N° 5 5869175..5869390 216 N° 6 5869017..5869051 35 N° 7 5868925..5868973 49 N° 8 5868730..5868814 85
complement(join(5868730..5868814,5868925..5868973,5869017..5869051,5869175..5869 390,5869446..5869675,5869748..5869887,5870043..5870295,5870403..5870513))


exon

Literature and cross-references TmesCcP01 (CCP1)
DNA ref. JGI genome:   scaffold_1 (5870513..5868730)
Cluster/Prediction ref. JGI gene:   42475
Protein sequence: TmesCcP01 (CCP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   374
PWM (Da):   %s   41271.62  
PI (pH):   %s   8.56
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFRVTPMLRAAARRPVQPVLRTPVLKRRFASGGPDVPPPPPPRSSNVPIFLGVLGVAAAGTAYYFYGTPGSAKDTGKELDSKIRGAVATVEGKVGLRRGKDEYQKVYDRIAETLDAEGYDDGSLAPVFIRLAWHASGTYNKEDGTGGSNYATMRFPAEASHGANNGNIARDHMEKIKKEFPWISYGDLWTLGGVCAVQEAGGPTIPWRPGRIDGFETNVTPDGRLPDASQAQDHLRFIFYRMGFNDQEIVALSGAHAMGRCHTDRSGFDGPWTFSPVTFSNQYFDLLLNEPWQWKKWKGPAQYEDKKTHTLMMLPTDMALIKDKSKKYVEKYAKSEEAFFEDFSKAFGTLLELGVPTSQFAGEPWTMGS

Retrieve as FASTA  
Remarks complete sequence from genomic (8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTTCGCGTCACTCCCATGCTTCGTGCAGCAGCCAGACGACCTGTTCAACCTGTTCTCCGTACTCCCGTCTTGAAGAGACGTTTCGCCTCGGGTGGACCTGATGTAGTACGTTTC
TTCCGTGCATCATCCTTCTCAGCTATCCGTAGGATCATGCAGGACGAATACGCTTCATTGACATCAATGGTGAGAGACGGCAAAAGCTGATAAATCAGCCTCCCCCTCCACCGCCTAGGA
GTTCAAACGTTCCTATTTTCCTCGGTGTTCTCGGAGTAGCAGCAGCCGGTACGGCTTATTATTTCTACGGTACTCCTGGTTCTGCGAAAGATACAGGTAAAGAGCTCGACAGTAAGATCA
GAGGTGCTGTGGCTACTGTGGAAGGCAAAGTCGGTTTGAGACGAGGCAAGGATGAATATCAGAAAGTGTACGATAGGATCGCCGAAACTTTGGACGCTGAGGGATACGATG
GTGAGTAAT
TCCTCTACTCTCCACTCTTTCGCATCTTCCCTACAGACCTCGAACCATCCACTAAGCTGATTCACCTGGCCGCCTGGGGTAGTTTGGGTTGAAATCGTCTAGTCCTCTCTGTTCCCAATA
TCAGATTTCTTTTTGCTGATGCGCAGACGGCTCCCTAGCTCCGGTCTTCATCCGTCTGGCATGGCACGCTTCTGGAACGTACAACAAAGAAGACGGTACTGGAGGATCAAACTATGCTAC
TATGCGTTTCCCCGCCGAGGCTTCGCATGGGGCTAACAACGGTCTG
GTCAGTCGATCTCTTCCATCCTCTTTCTCTCAGTCTCAAGCAAGTAAGCTCCAGAAAAATGTTGATGATCAGAA
CATTGCTAGAGATCACATGGAAAAAATCAAGAAAGAATTCCCTTGGATCTCGTATGGCGATTTATGGACTTTGGGAGGTGTTTGTGCCGTACAAGAAGCAGGAGGACCTACTATCCCTTG
GCGTCCGGGGAGGATCGACGGATTCGAAACCAATGTCACTCCTGATGGACGATTACCAGATGCCAGTCAAGCGCAAGATCATCTCCGATTTATCTTTTACCGAATGGG
GTGGGTGTTGAT
CTCTCCTTTTGTGGTGTGAGATGGAACGCGCGCTGACGTACAGCTTCAACGACCAAGAAATTGTCGCTTTATCTGGAGCACACGCAATGGGTAGATGTCATACCGATCGATCTGGCTTTG
ACGGTCCTTGGACTTTCTCCCCAGTGACATTCAGTAATCAATACTTTGATTTATTACTCAACGAACCTTGGCAATGGAAGAAATGGAAAGGTCCTGCGCAATATGAAGATAAGAAGACTC
ATACACTCATGATGCTTCC
GTGGGTTTAATCTTGCTTTGACCCGTTTTCAAACCGTCTCCCCTCACAAGAGCCTAACCCCTCTAGGTTCAGCATCGCAACAGCTGCGGGAAGAGATCATA
TTTGAGAAGTACTGATGAATAGGACCGATATGGCTTTGATCAAGGACAAATCTTTCAGTGCGTTTACATCTTTAAATACGATGTCATACTGATCATGTAGAAAAGTACGTGGAGAAGTAC
GCCAAGTCAGAAGAGGCTTTCTTTGAAGA
GTGAGTCTTTTCCCATTCTTCTTCCTTGGCCCTCCTGCAGCCACACTCAACATTCTGCGATCATCTGCGTGTCATGAACAAGTCTACTCGT
ACATGTCACTAATGTCAAGCTTCTCCAAGGCCTTCGGCACGTTGCTCGAGCTCGGAGTCCCCACTTCGCAGTTCGCAGGTGAACCTTGGACCATGGGATCCAGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTTCGCGTCACTCCCATGCTTCGTGCAGCAGCCAGACGACCTGTTCAACCTGTTCTCCGTACTCCCGTCTTGAAGAGACGTTTCGCCTCGGGTGGACCTGATGTACCTCCCCCT
CCACCGCCTAGGAGTTCAAACGTTCCTATTTTCCTCGGTGTTCTCGGAGTAGCAGCAGCCGGTACGGCTTATTATTTCTACGGTACTCCTGGTTCTGCGAAAGATACAGGTAAAGAGCTC
GACAGTAAGATCAGAGGTGCTGTGGCTACTGTGGAAGGCAAAGTCGGTTTGAGACGAGGCAAGGATGAATATCAGAAAGTGTACGATAGGATCGCCGAAACTTTGGACGCTGAGGGATAC
GATG
ACGGCTCCCTAGCTCCGGTCTTCATCCGTCTGGCATGGCACGCTTCTGGAACGTACAACAAAGAAGACGGTACTGGAGGATCAAACTATGCTACTATGCGTTTCCCCGCCGAGGCT
TCGCATGGGGCTAACAACGGTCTG
AACATTGCTAGAGATCACATGGAAAAAATCAAGAAAGAATTCCCTTGGATCTCGTATGGCGATTTATGGACTTTGGGAGGTGTTTGTGCCGTACAA
GAAGCAGGAGGACCTACTATCCCTTGGCGTCCGGGGAGGATCGACGGATTCGAAACCAATGTCACTCCTGATGGACGATTACCAGATGCCAGTCAAGCGCAAGATCATCTCCGATTTATC
TTTTACCGAATGGG
CTTCAACGACCAAGAAATTGTCGCTTTATCTGGAGCACACGCAATGGGTAGATGTCATACCGATCGATCTGGCTTTGACGGTCCTTGGACTTTCTCCCCAGTGACA
TTCAGTAATCAATACTTTGATTTATTACTCAACGAACCTTGGCAATGGAAGAAATGGAAAGGTCCTGCGCAATATGAAGATAAGAAGACTCATACACTCATGATGCTTCC
GACCGATATG
GCTTTGATCAAGGACAAATCTTTCA
AAAAGTACGTGGAGAAGTACGCCAAGTCAGAAGAGGCTTTCTTTGAAGACTTCTCCAAGGCCTTCGGCACGTTGCTCGAGCTCGGAGTCCCCACT
TCGCAGTTCGCAGGTGAACCTTGGACCATGGGATCCAGC

Retrieve as FASTA