Entry information : OsPrx59 (Os04g59160)
Entry ID 1069
Creation 2006-06-26 (Filippo Passardi)
Last sequence changes 2006-06-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx59 (Os04g59160)
Name (synonym) OsPrx59 (Os04g59160)
Class Class III peroxidase    [Orthogroup: Prx188]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx59
start..stop
S start..stop
HvPrx44 449 9e-160 9..348 7..348
OsPrx64 367 3e-127 2..348 4..338
TaPrx66 363 9e-126 8..348 13..341
HvPrx03 361 4e-125 5..348 7..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35228529..35228801 273 N° 2 35228250..35228435 186 N° 3 35227581..35228168 588  
complement(join(35227581..35228168,35228250..35228435,35228529..35228801))


exon

Literature and cross-references OsPrx59 (Os04g59160)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q7XSV1
DNA ref. GenBank:   NC_008397.1 (35228801..35227584)
Protein sequence: OsPrx59 (Os04g59160)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (324)
PWM (Da):   %s   37027.56 (34524.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.6 (4.45) Peptide Signal:   %s   cut: 26 range:25-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALRRMGIILVLLAIATLLSPAVSARFISLPTDHLPITTPPLADGLGFDLYSDSCPQLETTVRSAVQAALQQEIALAAGLLRIFFHDCFPQGCDASLLLTGANSEQQLPPNLTLQPRALQLIEDIRAQVHAACGPTVSCADITALATRDAIVASGGLPYDVPLGRLDSFAPAPSDAVFQLPQPTSDVSTLLSAFQTRNLDNVDLVALSGGHSIGRARCSSFSNRFREDDDFARRLAANCSNDGSRLQELDVTTPDVFDNKYYSNLVAGQGVFTSDQGLTGDWRTSWVVNGFAGNHWWFYGQFGSSMVKLGQLQGPSGNVGEIRRNSCFVPNSQTILAAAGDDGFTASA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, introns 1 and 2). No ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTGAGAAGAATGGGCATCATTCTTGTGCTCTTGGCCATTGCTACTCTGCTCTCGCCGGCAGTGTCCGCACGGTTCATCTCTCTGCCCACCGACCATCTTCCAATCACTACGCCG
CCCCTCGCCGACGGCCTCGGCTTCGACCTCTACAGCGACTCGTGCCCGCAGCTGGAGACCACCGTGCGCTCCGCCGTGCAGGCGGCGCTCCAGCAGGAGATCGCCCTCGCCGCCGGCCTC
CTCCGCATCTTCTTCCACGACTGCTTCCCCCAG
GTACTTGTTACTGATTTTGTTGTTGATTAAGTAATGAACACTAGGTTAGCTAGCTCTGTCAACCTAACCTAATTAACCTAATTGAAT
TTGCAGGGCTGCGACGCGTCGCTGCTTCTGACGGGAGCCAACAGCGAGCAGCAGCTGCCGCCCAACCTGACTCTGCAACCACGGGCGCTGCAGCTCATCGAGGACATCCGCGCCCAGGTG
CACGCCGCATGCGGCCCCACCGTCTCCTGCGCCGACATCACCGCCCTCGCCACCCGCGACGCCATCGTCGCC
GTACGTACAGATCGATACATGTTTGCCCATTGTGCATATATATATACT
GCATCAACGTACTGATCGATGCTTGCATTGCAGTCCGGTGGTCTGCCCTACGACGTGCCGCTCGGCCGCCTCGACAGCTTCGCGCCGGCTCCCAGCGACGCCGTCTTCCAGCTCCCGCAG
CCCACCTCCGACGTCTCCACGCTGCTCAGCGCCTTCCAGACCCGCAACCTCGACAACGTCGACCTCGTCGCGCTCTCCGGCGGCCACTCCATCGGCAGGGCGCGATGCAGCTCCTTCTCC
AACCGCTTCCGCGAGGACGACGACTTCGCCAGGAGGCTCGCCGCCAACTGCTCTAACGACGGCAGCCGCCTGCAGGAGCTTGATGTCACCACCCCGGACGTGTTCGACAACAAGTACTAC
AGCAACCTGGTGGCCGGTCAGGGGGTGTTCACCTCCGACCAGGGGCTCACCGGCGACTGGCGCACCAGCTGGGTGGTCAATGGCTTCGCCGGCAACCACTGGTGGTTCTACGGCCAGTTC
GGCAGCTCCATGGTGAAGCTGGGACAGCTCCAGGGTCCTTCAGGGAACGTCGGCGAGATCCGCCGCAACAGCTGCTTCGTGCCCAACAGCCAGACCATCCTTGCGGCCGCCGGCGACGAT
GGCTTCACGGCATCTGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTGAGAAGAATGGGCATCATTCTTGTGCTCTTGGCCATTGCTACTCTGCTCTCGCCGGCAGTGTCCGCACGGTTCATCTCTCTGCCCACCGACCATCTTCCAATCACTACGCCG
CCCCTCGCCGACGGCCTCGGCTTCGACCTCTACAGCGACTCGTGCCCGCAGCTGGAGACCACCGTGCGCTCCGCCGTGCAGGCGGCGCTCCAGCAGGAGATCGCCCTCGCCGCCGGCCTC
CTCCGCATCTTCTTCCACGACTGCTTCCCCCAG
GGCTGCGACGCGTCGCTGCTTCTGACGGGAGCCAACAGCGAGCAGCAGCTGCCGCCCAACCTGACTCTGCAACCACGGGCGCTGCAG
CTCATCGAGGACATCCGCGCCCAGGTGCACGCCGCATGCGGCCCCACCGTCTCCTGCGCCGACATCACCGCCCTCGCCACCCGCGACGCCATCGTCGCC
TCCGGTGGTCTGCCCTACGAC
GTGCCGCTCGGCCGCCTCGACAGCTTCGCGCCGGCTCCCAGCGACGCCGTCTTCCAGCTCCCGCAGCCCACCTCCGACGTCTCCACGCTGCTCAGCGCCTTCCAGACCCGCAACCTCGAC
AACGTCGACCTCGTCGCGCTCTCCGGCGGCCACTCCATCGGCAGGGCGCGATGCAGCTCCTTCTCCAACCGCTTCCGCGAGGACGACGACTTCGCCAGGAGGCTCGCCGCCAACTGCTCT
AACGACGGCAGCCGCCTGCAGGAGCTTGATGTCACCACCCCGGACGTGTTCGACAACAAGTACTACAGCAACCTGGTGGCCGGTCAGGGGGTGTTCACCTCCGACCAGGGGCTCACCGGC
GACTGGCGCACCAGCTGGGTGGTCAATGGCTTCGCCGGCAACCACTGGTGGTTCTACGGCCAGTTCGGCAGCTCCATGGTGAAGCTGGGACAGCTCCAGGGTCCTTCAGGGAACGTCGGC
GAGATCCGCCGCAACAGCTGCTTCGTGCCCAACAGCCAGACCATCCTTGCGGCCGCCGGCGACGATGGCTTCACGGCATCTGCTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTGA GAAGAATGGG CATCATTCTT GTGCTCTTGG CCATTGCTAC TCTGCTCTCG CCGGCAGTGT CCGCACGGTT CATCTCTCTG CCCACCGACC ATCTTCCAAT CACTACGCCG  CCCCTCGCCG ACGGCCTCGG CTTCGACCTC TACAGCGACT CGTGCCCGCA GCTGGAGACC ACCGTGCGCT CCGCCGTGCA GGCGGCGCTC CAGCAGGAGA TCGCCCTCGC CGCCGGCCTC  CTCCGCATCT TCTTCCACGA CTGCTTCCCC CAGGGCTGCG ACGCGTCGCT GCTTCTGACG GGAGCCAACA GCGAGCAGCA GCTGCCGCCC AACCTGACTC TGCAACCACG GGCGCTGCAG  CTCATCGAGG ACATCCGCGC CCAGGTGCAC GCCGCATGCG GCCCCACCGT CTCCTGCGCC GACATCACCG CCCTCGCCAC CCGCGACGCC ATCGTCGCCT CCGGTGGTCT GCCCTACGAC  GTGCCGCTCG GCCGCCTCGA CAGCTTCGCG CCGGCTCCCA GCGACGCCGT CTTCCAGCTC CCGCAGCCCA CCTCCGACGT CTCCACGCTG CTCAGCGCCT TCCAGACCCG CAACCTCGAC  AACGTCGACC TCGTCGCGCT CTCCGGCGGC CACTCCATCG GCAGGGCGCG ATGCAGCTCC TTCTCCAACC GCTTCCGCGA GGACGACGAC TTCGCCAGGA GGCTCGCCGC CAACTGCTCT  AACGACGGCA GCCGCCTGCA GGAGCTTGAT GTCACCACCC CGGACGTGTT CGACAACAAG TACTACAGCA ACCTGGTGGC CGGTCAGGGG GTGTTCACCT CCGACCAGGG GCTCACCGGC  GACTGGCGCA CCAGCTGGGT GGTCAATGGC TTCGCCGGCA ACCACTGGTG GTTCTACGGC CAGTTCGGCA GCTCCATGGT GAAGCTGGGA CAGCTCCAGG GTCCTTCAGG GAACGTCGGC 
GAGATCCGCC GCAACAGCTG CTTCGTGCCC AACAGCCAGA CCATCCTTGC GGCCGCCGGC GACGATGGCT TCACGGCATC TGCTTGA 

Retrieve as FASTA