Entry information : PcriCcP
Entry ID 10691
Creation 2012-03-05 (Christophe Dunand)
Last sequence changes 2012-03-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: PcriCcP
Name PcriCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Plicaturopsis
Organism Plicaturopsis crispa    [TaxId: 139390 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcriCcP
start..stop
S start..stop
Fcbs109695CcP01 572 0 14..371 17..373
SnivCcP01 568 0 3..371 1..367
SlacCcP01 565 0 1..370 1..371
AthiCcP01 559 0 1..371 1..371
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1612724..1613017 294 N° 2 1612522..1612652 131 N° 3 1612169..1612439 271 N° 4 1612024..1612106 83
N° 5 1611820..1611969 150 N° 6 1611658..1611741 84 N° 7 1611479..1611581 103  
complement(join(1611479..1611581,1611658..1611741,1611820..1611969,1612024..1612 106,1612169..1612439,1612522..1612652,1612724..1613017))


exon

Literature and cross-references PcriCcP
DNA ref. JGI genome:   scaffold_3 (1613017..1611479)
Cluster/Prediction ref. JGI gene:   37408
Protein sequence: PcriCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   372
PWM (Da):   %s   40997.73  
PI (pH):   %s   9.31
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFSSLRAPARNALRFPKAQQLRSSVRKYSTETPTPPKPKSSNNALVYGGIAAVALGGAGYLLSSEDARRSLGTVFKSSAQSAKASAGFTPTKEDYQKVYNKIAELLDEAGEYDDGSYGPVILRLAWHSSGTYDKDTNTGGSNYATMRFEPEALHGANAGLNVARGLMEKIKAEFPWISYGDLWTLGGVAAVQELQGPKIAWRPGRVDGFAKDATPDGRLPDAAQGSDHLRIFYRMGFNDQEIVALSGAHALGRCHTDRSGFEGPWTFSPITLTNDYYKLLFEEKWVWRKWGGPKQLADKKTGSLMMLPTDYVLTQDKSFKKYAKAYAEDQDLFFKDFSAVVSKLFELGIPPKQFSSEPYTLKTLEEQKQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCTCCTCCCTCCGCGCGCCCGCTCGCAACGCCCTCCGCTTCCCAAAGGCGCAGCAGCTGCGCTCGTCGGTGCGTAAGTACTCGACAGAGACGCCGACGCCGCCCAAGCCCAAG
TCCAGCAACAACGCACTCGTGTACGGTGGTATTGCGGCCGTCGCCCTCGGCGGCGCCGGCTACCTCCTCTCCTCCGAGGACGCGCGCAGGTCGCTCGGCACGGTCTTCAAGTCGAGCGCA
CAGTCCGCCAAGGCGAGCGCGGGCTTCACGCCCACCAAGGAGGACTACCAGAAG
GTGCGAGTGCGAGCGGCGCGGCTGCGTGGGAGTGTGCGTGTGTTGCTAACCAGTGCGTGTGTGGGG
TAAAGGTGTACAACAAAATTGCCGAGCTGCTGGACGAGGCTGGGGAATACGATGATGGGTCGTACGGCCCTGTGATCCTGCGTCTCGCCTGGCACAGTTCCGGCACCTACGACAAGGACA
CCAACACCGGTGGCAG
GTCCGTATCCCCCCCTCTCCCAACTATCCATCCATCCATCCATACCTACCTATACTCACGTCCACGGCCTTGACCTTAACAGCAACTACGCGACGATGCGCTTC
GAGCCCGAGGCCCTGCACGGCGCGAACGCGGGGCTGAACGTCGCGCGCGGGCTGATGGAGAAGATCAAGGCGGAGTTCCCGTGGATCAGCTACGGCGACCTGTGGACCCTCGGCGGCGTG
GCGGCCGTGCAGGAGTTGCAGGGCCCGAAGATTGCGTGGAGGCCTGGCCGGGTGGACGGGTTCGCGAAGGATGCGACGCCCGATGGCAGGCTGCCGGACGCGGCGCAGGGGTCTGATCAC
CTTCGGAAT
GTGAGTTATTTGAATTGGTTGGTTGATGGGAGGCTGGGGCTGATGGATGGATGCGGGTGTAGATCTTTTACCGTATGGGCTTCAATGACCAGGAGATTGTTGCGCTCTCCG
GTGCGCATGCGCTCGGGCGCTGCCACACTGACCG
GTACGTCGCCCACCTACTCAACCGCACCACTCCCTCTTACTTAGCATTCAACAGCTCGGGCTTCGAGGGCCCCTGGACGTTCTCCC
CCATCACGCTCACCAACGACTACTACAAGCTCCTCTTCGAGGAGAAGTGGGTCTGGCGCAAGTGGGGCGGGCCCAAGCAGCTCGCGGATAAGAAGACCGGCTCGCTCATGATGCTCCC
GT
ACGTCCCTCGATTGCACACATCTATATATGGAGGAGGAGGAGGAGGTGGCTGATGTGTTACTGGACTGGCTGGTAGGACGGACTACGTGCTGACGCAGGACAAGAGCTTCAAGAAGTACG
CGAAGGCATACGCCGAGGATCAGGACCTCTTCTTCAAAGA
GTACGTCCTTTCTTTCTCTTTCTCTTTCTATGTCCCCCACGCATGCCTAATGCTAACCTAACCTAACGCATGGCAGCTTC
TCCGCGGTCGTGAGCAAGCTCTTCGAGCTCGGCATCCCGCCGAAGCAGTTCTCCTCCGAGCCGTATACGCTGAAGACGCTCGAGGAGCAGAAGCAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCTCCTCCCTCCGCGCGCCCGCTCGCAACGCCCTCCGCTTCCCAAAGGCGCAGCAGCTGCGCTCGTCGGTGCGTAAGTACTCGACAGAGACGCCGACGCCGCCCAAGCCCAAG
TCCAGCAACAACGCACTCGTGTACGGTGGTATTGCGGCCGTCGCCCTCGGCGGCGCCGGCTACCTCCTCTCCTCCGAGGACGCGCGCAGGTCGCTCGGCACGGTCTTCAAGTCGAGCGCA
CAGTCCGCCAAGGCGAGCGCGGGCTTCACGCCCACCAAGGAGGACTACCAGAAG
GTGTACAACAAAATTGCCGAGCTGCTGGACGAGGCTGGGGAATACGATGATGGGTCGTACGGCCCT
GTGATCCTGCGTCTCGCCTGGCACAGTTCCGGCACCTACGACAAGGACACCAACACCGGTGGCAG
CAACTACGCGACGATGCGCTTCGAGCCCGAGGCCCTGCACGGCGCGAACGCGGGG
CTGAACGTCGCGCGCGGGCTGATGGAGAAGATCAAGGCGGAGTTCCCGTGGATCAGCTACGGCGACCTGTGGACCCTCGGCGGCGTGGCGGCCGTGCAGGAGTTGCAGGGCCCGAAGATT
GCGTGGAGGCCTGGCCGGGTGGACGGGTTCGCGAAGGATGCGACGCCCGATGGCAGGCTGCCGGACGCGGCGCAGGGGTCTGATCACCTTCGGAAT
ATCTTTTACCGTATGGGCTTCAAT
GACCAGGAGATTGTTGCGCTCTCCGGTGCGCATGCGCTCGGGCGCTGCCACACTGACCG
CTCGGGCTTCGAGGGCCCCTGGACGTTCTCCCCCATCACGCTCACCAACGACTACTACAAG
CTCCTCTTCGAGGAGAAGTGGGTCTGGCGCAAGTGGGGCGGGCCCAAGCAGCTCGCGGATAAGAAGACCGGCTCGCTCATGATGCTCCC
GACGGACTACGTGCTGACGCAGGACAAGAGC
TTCAAGAAGTACGCGAAGGCATACGCCGAGGATCAGGACCTCTTCTTCAAAGA
CTTCTCCGCGGTCGTGAGCAAGCTCTTCGAGCTCGGCATCCCGCCGAAGCAGTTCTCCTCCGAGCCG
TATACGCTGAAGACGCTCGAGGAGCAGAAGCAGTAG

Retrieve as FASTA