Entry information : PbreCcP (CCP1)
Entry ID 10692
Creation 2012-03-05 (Christophe Dunand)
Last sequence changes 2012-03-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-28 (Catherine Mathe (Scipio))
Peroxidase information: PbreCcP (CCP1)
Name (synonym) PbreCcP (CCP1)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phlebia
Organism Phlebia brevispora    [TaxId: 194682 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PbreCcP
start..stop
S start..stop
CuniCcP01 551 0 5..384 2..378
PgigCcP 541 0 1..384 1..383
MfiaCcP01 533 0 1..382 1..378
TcamCcP 531 0 1..381 1..372
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 421250..421570 321 N° 2 421628..421682 55 N° 3 421737..421818 82 N° 4 421884..422154 271
N° 5 422223..422239 17 N° 6 422314..422529 216 N° 7 422596..422679 84 N° 8 422740..422848 109
join(421250..421570,421628..421682,421737..421818,421884..422154,422223..422239, 422314..422529,422596..422679,422740..422848)


exon

Literature and cross-references PbreCcP (CCP1)
DNA ref. JGI genome:   scaffold_15 (421250..422848)
Cluster/Prediction ref. JGI gene:   127776
Protein sequence: PbreCcP (CCP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   385
PWM (Da):   %s   42458.37  
PI (pH):   %s   8.94
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFNALRLSLRRTALPRPAPAIVRTRVAQRVPALRRFNSSQSTPPPPPPEPKKSSSLPIVVVVALAAGAGGYWFFTQPDSAGTVLKSGAQAAKVAANFVPTKQDYIQVYNKIADLFDEASDKNYDDGSYAPVILRLAWHSSGAYDKVSGTGGSNYATMRFAPESEHGANAGLNIARDLMEGIKKQFPWISYGDLWTLGGVCAIQEMGGPKVPWRPGRIDGVAAQATPDGRLPDGSKGAAHLRVFYRMGFNDQEIVALSGCHAVGRCHHDRSGFDGPWTFSPTTMSNDFFKLLFDETWVWKKWDGPKQLEDKKTHSLMMLPTDYVLVQDKNFKKYAKAYAEDEQLFFKDFSAAVARLFELGVPEKQWVTSEPWIMPNVDEQKSS

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCAACGCTCTACGTCTTTCGCTGCGCAGGACCGCTCTCCCGAGGCCTGCGCCTGCCATTGTGCGCACCCGCGTCGCCCAGCGCGTCCCGGCTCTGCGCAGGTTCAACTCCAGC
CAATCAACTCCCCCGCCTCCGCCCCCGGAGCCTAAAAAGTCAAGCTCTTTGCCTATTGTCGTAGTTGTAGCTCTTGCTGCGGGTGCCGGAGGCTACTGGTTCTTCACCCAGCCCGACTCC
GCAGGCACCGTCCTCAAGTCGGGCGCGCAGGCCGCCAAGGTCGCCGCCAACTTCGTTCCCACGAAGCAGGACTACATTCAG
GTGAGTATGACGCGTACTGTACCGCATTGCATAGCACAC
GTCCTAAGCATGTCTTAGGTGTACAACAAGATTGCCGACCTCTTCGACGAGGCGAGCGATAAGAACTACGACGGTGCACTTGACTCTCTTGCCTTTGCGTGCACACTGTCACTGACGCGT
CGTTAAGATGGCTCATACGCACCCGTCATCCTCCGGCTGGCATGGCACTCGTCTGGTGCCTACGACAAAGTGTCCGGTACAGGCGGAAGGTGCGTCACCGTCTCTCACGTCCATCCCCTA
TCGCATCACGCCGTTGCTCACAAGTGCTTATCAGCAACTATGCGACCATGCGCTTTGCGCCCGAGTCCGAGCACGGCGCGAACGCCGGCCTCAACATCGCCCGCGACCTGATGGAGGGCA
TCAAGAAGCAGTTCCCTTGGATCTCGTACGGCGACCTGTGGACCCTCGGCGGCGTCTGCGCCATCCAGGAGATGGGCGGCCCCAAGGTCCCATGGCGCCCCGGCCGCATTGACGGTGTCG
CAGCGCAGGCGACTCCCGATGGCCGACTCCCCGACGGCTCGAAAGGCGCAGCCCACCTCCGTGAT
GTGCGTTCCTTGTCCTTTCATGTGTAAGCCACACAGCGCTGACTTTGCATCCCCC
TCCCCACGCGCAGGTCTTCTACCGCATGGGGTGAGCACACTTTCAGCTGTTTCCATGTGAAGATTGTGGTGTGTGACTGACGGCACGCTCGCTGCGTATGACAGATTCAATGATCAGGAG
ATTGTCGCGCTCTCCGGCTGCCACGCGGTCGGCCGCTGCCACCACGACCGCTCCGGCTTCGACGGTCCCTGGACGTTCTCCCCCACTACTATGTCCAACGACTTCTTCAAGCTCCTCTTC
GACGAGACCTGGGTCTGGAAGAAATGGGACGGCCCCAAGCAGCTCGAGGACAAGAAGACGCACTCTCTCATGATGCTCCC
GTGCGTCGCTTTATGATTTGCCTTATGAGCGTGTGAACAG
GGTTGCTGATGGTGCATGTGGCGCAGGACGGACTACGTGCTCGTTCAGGATAAGAATTTCAAGAAGTACGCGAAGGCGTACGCGGAGGACGAGCAGCTGTTTTTCAAAGAGTAAGTGTCT
GCTGTTATTGTTCCTCCCCTCCCAAGTAAACTTACTTCTCTCTTCAACAGTTTCTCCGCCGCCGTCGCGCGCCTCTTCGAGCTCGGCGTGCCCGAGAAGCAGTGGGTCACTTCCGAGCCG
TGGATCATGCCCAACGTCGACGAGCAGAAGTCGTCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCAACGCTCTACGTCTTTCGCTGCGCAGGACCGCTCTCCCGAGGCCTGCGCCTGCCATTGTGCGCACCCGCGTCGCCCAGCGCGTCCCGGCTCTGCGCAGGTTCAACTCCAGC
CAATCAACTCCCCCGCCTCCGCCCCCGGAGCCTAAAAAGTCAAGCTCTTTGCCTATTGTCGTAGTTGTAGCTCTTGCTGCGGGTGCCGGAGGCTACTGGTTCTTCACCCAGCCCGACTCC
GCAGGCACCGTCCTCAAGTCGGGCGCGCAGGCCGCCAAGGTCGCCGCCAACTTCGTTCCCACGAAGCAGGACTACATTCAG
GTGTACAACAAGATTGCCGACCTCTTCGACGAGGCGAGC
GATAAGAACTACGACG
ATGGCTCATACGCACCCGTCATCCTCCGGCTGGCATGGCACTCGTCTGGTGCCTACGACAAAGTGTCCGGTACAGGCGGAAGCAACTATGCGACCATGCGCTTT
GCGCCCGAGTCCGAGCACGGCGCGAACGCCGGCCTCAACATCGCCCGCGACCTGATGGAGGGCATCAAGAAGCAGTTCCCTTGGATCTCGTACGGCGACCTGTGGACCCTCGGCGGCGTC
TGCGCCATCCAGGAGATGGGCGGCCCCAAGGTCCCATGGCGCCCCGGCCGCATTGACGGTGTCGCAGCGCAGGCGACTCCCGATGGCCGACTCCCCGACGGCTCGAAAGGCGCAGCCCAC
CTCCGTGAT
GTCTTCTACCGCATGGGATTCAATGATCAGGAGATTGTCGCGCTCTCCGGCTGCCACGCGGTCGGCCGCTGCCACCACGACCGCTCCGGCTTCGACGGTCCCTGGACGTTC
TCCCCCACTACTATGTCCAACGACTTCTTCAAGCTCCTCTTCGACGAGACCTGGGTCTGGAAGAAATGGGACGGCCCCAAGCAGCTCGAGGACAAGAAGACGCACTCTCTCATGATGCTC
CC
GACGGACTACGTGCTCGTTCAGGATAAGAATTTCAAGAAGTACGCGAAGGCGTACGCGGAGGACGAGCAGCTGTTTTTCAAAGATTTCTCCGCCGCCGTCGCGCGCCTCTTCGAGCTC
GGCGTGCCCGAGAAGCAGTGGGTCACTTCCGAGCCGTGGATCATGCCCAACGTCGACGAGCAGAAGTCGTCGTAG

Retrieve as FASTA