Entry information : PgigCcP
Entry ID 10693
Creation 2012-03-05 (Christophe Dunand)
Last sequence changes 2012-03-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-27 (Catherine Mathe (Scipio))
Peroxidase information: PgigCcP
Name PgigCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Phanerochaetaceae Phlebiopsis
Organism Phlebiopsis gigantea    [TaxId: 82310 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PgigCcP
start..stop
S start..stop
CuniCcP01 608 0 5..383 2..378
SlacCcP01 594 0 1..381 1..371
BaCcP 583 0 1..384 1..386
HsubCcP 576 0 1..384 1..377
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 52912..53229 318 N° 2 53290..53344 55 N° 3 53396..53477 82 N° 4 53531..54034 504
N° 5 54092..54175 84 N° 6 54230..54347 118  
join(52912..53229,53290..53344,53396..53477,53531..54034,54092..54175,54230..543 47)


exon

Literature and cross-references PgigCcP
DNA ref. JGI genome:   scaffold_69 (52912..54347)
Cluster/Prediction ref. JGI gene:   127931
Protein sequence: PgigCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   387
PWM (Da):   %s   42219.37  
PI (pH):   %s   9.25
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFAALRVSLRKAAVPAPSRAARAARFRAPAVRKYSTETPPPPPPPKSSNTTLYAGLGAAALGGVAFWVYTSSSDSAKVAGTAVKSGAQAAKVAANLVPTKEDYIKVYNRVAEIMDEAGDKEYDDGSYGPVLLRLAWHSSGTYDKDTQTGGSNYATMRFAPESQHGANAGLNVARDLMEQLKQEFPWISYGDLWTLGGVAAVQEMGGPKIPWRPGRIDGFAVQATPDGRLPDASQGSDHLRRIFGRMGFNDQEIVALSGGHAVGRCHSTRSGYEGPWTFSPTTITNDFFKLLFDETWVWKKWEGPKQLEDKKTRSLMMLPTDYVLVQDKVFKKFAKAYAQDQDLFFKDFSAAVAKLFELGVPTQQFVTAEPWILPTVDEQKEAKSA

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCGCCGCGCTGCGAGTCTCCCTCCGCAAGGCTGCCGTCCCCGCGCCCTCCAGGGCTGCCAGGGCTGCCCGCTTCCGTGCGCCCGCCGTGCGCAAGTACTCGACAGAGACCCCG
CCGCCGCCGCCCCCTCCCAAGTCGTCCAACACCACCCTATATGCTGGTTTGGGCGCGGCCGCCCTCGGCGGTGTCGCCTTCTGGGTCTACACCTCCAGCTCGGACTCGGCAAAGGTCGCC
GGCACTGCGGTCAAGTCTGGTGCCCAGGCCGCAAAGGTTGCTGCGAACCTCGTTCCCACGAAGGAGGACTACATCAAG
GTGCGTATCTCGCTGCATATGCCCCCCAGGGAAACATGCTGA
GGACCATCCCACGTTCAGGTTTACAACCGGGTCGCTGAGATCATGGACGAAGCCGGTGATAAGGAATACGATGGTAGGATTCACCTCGCCTTGGTTCTAGAATGTTAGCTGACAGCTGCC
AAAGATGGCTCCTACGGCCCCGTTCTCCTCCGTCTCGCATGGCATTCTTCGGGCACATACGACAAGGACACCCAGACCGGTGGCAGGTGAGCACCTCTCGAAGCGCGCAACGCACACGGG
GCTCACACGTCGTCTCCAGCAACTACGCCACCATGCGCTTCGCGCCTGAGTCGCAGCACGGCGCGAACGCGGGGCTAAACGTCGCGCGCGACCTGATGGAGCAGCTCAAGCAGGAGTTCC
CGTGGATCTCGTACGGCGACCTGTGGACTCTCGGCGGCGTTGCGGCGGTGCAGGAGATGGGCGGTCCCAAGATCCCGTGGCGGCCGGGGCGCATCGACGGCTTTGCGGTGCAGGCGACGC
CCGACGGCCGCCTGCCCGACGCGAGCCAGGGCTCGGACCACCTGCGCCGCATCTTCGGGCGCATGGGCTTCAACGACCAGGAGATCGTCGCGCTGAGCGGCGGGCACGCCGTCGGCCGCT
GCCACAGCACGCGCTCGGGCTACGAGGGCCCGTGGACGTTCTCGCCCACCACGATCACGAACGACTTTTTCAAGCTCCTGTTCGACGAGACGTGGGTGTGGAAGAAGTGGGAGGGCCCGA
AGCAGCTCGAGGACAAGAAGACGCGCTCGCTCATGATGCTTCC
GTGAGTGCCGACTATCGACGTGCTCGCTCTGTCCGGTCTCTTACCCCTTATAACTAGCACCGACTACGTCCTCGTCC
AGGACAAGGTCTTCAAGAAGTTCGCCAAGGCTTACGCGCAGGACCAGGACCTCTTCTTCAAGGA
GTACGTTTCCACCTTTTCTCGCGCCCCAAACTTGGACTGACCCCCACACCCCAGCT
TCTCCGCCGCCGTCGCGAAGCTCTTCGAGCTCGGCGTGCCGACGCAGCAGTTCGTCACCGCTGAGCCGTGGATCCTGCCCACCGTCGACGAGCAGAAGGAGGCCAAGTCCGCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCGCCGCGCTGCGAGTCTCCCTCCGCAAGGCTGCCGTCCCCGCGCCCTCCAGGGCTGCCAGGGCTGCCCGCTTCCGTGCGCCCGCCGTGCGCAAGTACTCGACAGAGACCCCG
CCGCCGCCGCCCCCTCCCAAGTCGTCCAACACCACCCTATATGCTGGTTTGGGCGCGGCCGCCCTCGGCGGTGTCGCCTTCTGGGTCTACACCTCCAGCTCGGACTCGGCAAAGGTCGCC
GGCACTGCGGTCAAGTCTGGTGCCCAGGCCGCAAAGGTTGCTGCGAACCTCGTTCCCACGAAGGAGGACTACATCAAG
GTTTACAACCGGGTCGCTGAGATCATGGACGAAGCCGGTGAT
AAGGAATACGATG
ATGGCTCCTACGGCCCCGTTCTCCTCCGTCTCGCATGGCATTCTTCGGGCACATACGACAAGGACACCCAGACCGGTGGCAGCAACTACGCCACCATGCGCTTCGCG
CCTGAGTCGCAGCACGGCGCGAACGCGGGGCTAAACGTCGCGCGCGACCTGATGGAGCAGCTCAAGCAGGAGTTCCCGTGGATCTCGTACGGCGACCTGTGGACTCTCGGCGGCGTTGCG
GCGGTGCAGGAGATGGGCGGTCCCAAGATCCCGTGGCGGCCGGGGCGCATCGACGGCTTTGCGGTGCAGGCGACGCCCGACGGCCGCCTGCCCGACGCGAGCCAGGGCTCGGACCACCTG
CGCCGCATCTTCGGGCGCATGGGCTTCAACGACCAGGAGATCGTCGCGCTGAGCGGCGGGCACGCCGTCGGCCGCTGCCACAGCACGCGCTCGGGCTACGAGGGCCCGTGGACGTTCTCG
CCCACCACGATCACGAACGACTTTTTCAAGCTCCTGTTCGACGAGACGTGGGTGTGGAAGAAGTGGGAGGGCCCGAAGCAGCTCGAGGACAAGAAGACGCGCTCGCTCATGATGCTTCC
C
ACCGACTACGTCCTCGTCCAGGACAAGGTCTTCAAGAAGTTCGCCAAGGCTTACGCGCAGGACCAGGACCTCTTCTTCAAGGA
CTTCTCCGCCGCCGTCGCGAAGCTCTTCGAGCTCGGC
GTGCCGACGCAGCAGTTCGTCACCGCTGAGCCGTGGATCCTGCCCACCGTCGACGAGCAGAAGGAGGCCAAGTCCGCGTGA

Retrieve as FASTA