Entry information : FpinCcP (CCP1)
Entry ID 10696
Creation 2012-03-05 (Christophe Dunand)
Last sequence changes 2012-03-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: FpinCcP (CCP1)
Name (synonym) FpinCcP (CCP1)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Fomitopsis
Organism Fomitopsis pinicola    [TaxId: 40483 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FpinCcP
start..stop
S start..stop
WcoCcP 606 0 1..371 1..366
PplCcP01-1A 590 0 1..375 1..371
TcamCcP 588 0 1..375 1..370
CsuCcP 585 0 1..371 1..372
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 688622..688930 309 N° 2 688986..689040 55 N° 3 689091..689172 82 N° 4 689222..689492 271
N° 5 689546..689778 233 N° 6 689835..689918 84 N° 7 689976..690069 94  
join(688622..688930,688986..689040,689091..689172,689222..689492,689546..689778, 689835..689918,689976..690069)


exon

Literature and cross-references FpinCcP (CCP1)
DNA ref. JGI genome:   scaffold_1 (688622..690069)
Cluster/Prediction ref. GenPept:   66252
Protein sequence: FpinCcP (CCP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   375
PWM (Da):   %s   41502.92  
PI (pH):   %s   9.25
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFSAFRASLRKAPLNVARPTRALRTTGLRRYTTEVPKPEAPKKSNTALFAGIGAAAAVGGITLYIYTSNSDNAKEAGTLAKSGAQALKVAANFAPTKEDYEKVYKRIAEILDEASDKSYDDGSYGPVLVRLAWHSSGTYDKESGTGGSNYATMRFEPEAKHGANNGLNVARELMEGIKKEFPWISYGDLWTLGGVCAIQEMGGPKIPWRPGRIDGFAAQATPDGRLPDASQGAQHLRIFYRMGFNDQEIVALSGAHALGRCHRDRSGFDGPWTFSPVTVSNEYFRLLLEEKWLWRKWDGPKQLEDKTTKTLMMLPTDYALVQDKSFKKFVDVYAKDQDKWFEDFSKVVSTLFELGVPRQQFVTSEAWTMGGEE

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCAGCGCATTCAGAGCATCCCTCCGCAAGGCCCCTCTCAACGTCGCGCGCCCCACCCGCGCGTTGCGCACGACAGGCCTTAGGCGCTATACCACGGAGGTACCCAAGCCGGAG
GCCCCGAAGAAGAGTAACACCGCACTCTTCGCTGGAATCGGTGCCGCCGCCGCCGTCGGTGGCATTACCTTATACATCTACACCAGCAATTCCGACAATGCGAAGGAGGCGGGGACCCTC
GCAAAGTCCGGTGCACAGGCGTTGAAGGTCGCCGCGAACTTCGCCCCCACGAAGGAGGACTACGAGAAG
GTACGTTGCCTGAAGATAAGTTATTAGGATAATGTTCTCACACAGAACTGT
ACAGGTCTACAAGAGAATTGCCGAAATTCTTGACGAGGCATCGGACAAGAGTTACGATGGTACGCTCGTCGGAAACCGACGCAACTCTCCGCGCTAATCAATGTCCCAGATGGCTCGTAC
GGCCCCGTCCTCGTCCGTCTCGCATGGCACTCCTCCGGTACCTACGACAAGGAGTCGGGCACCGGTGGTAG
GTAAGCCACTTCCTTTCACCCCTGCGGCCCGATCTCACGTCGCGACCAG

CAACTACGCCACCATGCGCTTCGAGCCCGAAGCGAAGCATGGCGCGAACAACGGCCTAAACGTCGCACGCGAATTGATGGAGGGCATCAAGAAGGAGTTCCCCTGGATCTCCTACGGCGA
CCTCTGGACGCTCGGCGGTGTCTGCGCCATCCAGGAGATGGGCGGGCCCAAGATTCCCTGGCGGCCGGGCCGCATCGACGGCTTCGCTGCCCAGGCGACGCCCGACGGCCGTCTCCCCGA
CGCCTCACAGGGCGCGCAGCACCTGAGGAAT
GTGCGTAGCCTTTGCACGCTTGCGCATCGCACAAAGAGCTGACACGGAGACAGATCTTCTACCGCATGGGCTTCAACGACCAAGAGATC
GTCGCGCTCTCCGGCGCGCACGCTCTTGGACGCTGCCACCGTGATCGCTCGGGCTTCGACGGTCCCTGGACGTTCTCGCCCGTGACCGTCTCGAACGAGTATTTCCGCCTGCTCCTCGAG
GAGAAGTGGCTCTGGCGCAAGTGGGACGGCCCGAAGCAGCTCGAGGACAAGACTACCAAGACGCTCATGATGCTCCC
GTGCGTACCTCTTTGCTTCCGGATCCGGGGTAAGTAGGCTGAC
CCCTTTGGTTCAGGACGGATTATGCGCTAGTCCAGGACAAGAGCTTCAAGAAGTTCGTTGACGTGTACGCGAAGGATCAGGATAAGTGGTTCGAGGAGTGCGTGCCCCTGTTGATATTGA
GTCATGTCTCGAGCTGACTGATTCGCATTCGCAGTTTCTCCAAGGTTGTCTCGACCCTTTTCGAGCTCGGTGTCCCCCGCCAGCAGTTTGTCACCTCGGAGGCTTGGACCATGGGTGGGG
AAGAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCAGCGCATTCAGAGCATCCCTCCGCAAGGCCCCTCTCAACGTCGCGCGCCCCACCCGCGCGTTGCGCACGACAGGCCTTAGGCGCTATACCACGGAGGTACCCAAGCCGGAG
GCCCCGAAGAAGAGTAACACCGCACTCTTCGCTGGAATCGGTGCCGCCGCCGCCGTCGGTGGCATTACCTTATACATCTACACCAGCAATTCCGACAATGCGAAGGAGGCGGGGACCCTC
GCAAAGTCCGGTGCACAGGCGTTGAAGGTCGCCGCGAACTTCGCCCCCACGAAGGAGGACTACGAGAAG
GTCTACAAGAGAATTGCCGAAATTCTTGACGAGGCATCGGACAAGAGTTAC
GATG
ATGGCTCGTACGGCCCCGTCCTCGTCCGTCTCGCATGGCACTCCTCCGGTACCTACGACAAGGAGTCGGGCACCGGTGGTAGCAACTACGCCACCATGCGCTTCGAGCCCGAAGCG
AAGCATGGCGCGAACAACGGCCTAAACGTCGCACGCGAATTGATGGAGGGCATCAAGAAGGAGTTCCCCTGGATCTCCTACGGCGACCTCTGGACGCTCGGCGGTGTCTGCGCCATCCAG
GAGATGGGCGGGCCCAAGATTCCCTGGCGGCCGGGCCGCATCGACGGCTTCGCTGCCCAGGCGACGCCCGACGGCCGTCTCCCCGACGCCTCACAGGGCGCGCAGCACCTGAGGAAT
ATC
TTCTACCGCATGGGCTTCAACGACCAAGAGATCGTCGCGCTCTCCGGCGCGCACGCTCTTGGACGCTGCCACCGTGATCGCTCGGGCTTCGACGGTCCCTGGACGTTCTCGCCCGTGACC
GTCTCGAACGAGTATTTCCGCCTGCTCCTCGAGGAGAAGTGGCTCTGGCGCAAGTGGGACGGCCCGAAGCAGCTCGAGGACAAGACTACCAAGACGCTCATGATGCTCCC
GACGGATTAT
GCGCTAGTCCAGGACAAGAGCTTCAAGAAGTTCGTTGACGTGTACGCGAAGGATCAGGATAAGTGGTTCGAGGA
TTTCTCCAAGGTTGTCTCGACCCTTTTCGAGCTCGGTGTCCCCCGC
CAGCAGTTTGTCACCTCGGAGGCTTGGACCATGGGTGGGGAAGAGTAG

Retrieve as FASTA