Entry information : GsppCcP
Entry ID 10697
Creation 2012-03-05 (Christophe Dunand)
Last sequence changes 2012-03-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-22 (Catherine Mathe (Scipio))
Peroxidase information: GsppCcP
Name GsppCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Fungi/Metazoa; Fungi; Basidiomycota; Basidiomycota
Organism Ganoderma sp. 10597 SS1    [TaxId: 767862 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GsppCcP
start..stop
S start..stop
ParcCcP01 582 0 1..370 1..380
DsCcP 574 0 24..369 23..374
TvCcP 548 0 26..369 27..380
MfiaCcP01 546 0 1..369 1..377
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 390739..391023 285 N° 2 391130..391184 55 N° 3 391270..391351 82 N° 4 391494..391764 271
N° 5 391838..391854 17 N° 6 391933..392232 300 N° 7 392303..392405 103  
join(390739..391023,391130..391184,391270..391351,391494..391764,391838..391854, 391933..392232,392303..392405)


exon

Literature and cross-references GsppCcP
DNA ref. JGI genome:   scaffold_3 (390739..392405)
Cluster/Prediction ref. JGI gene:   115729
Protein sequence: GsppCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   371
PWM (Da):   %s   40726.42  
PI (pH):   %s   8.53
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFAALRASARRTTASAARVSPRVAVRNAAVRRYATESAPPPPPKSSNAALFGAIGAAALAGGAYYVFSSSDSATETKASIHAANYVPTKEDYQKVYNRVADIFDKAADKNYDDGSYGPVILRLAWHSSGTYDKETGTGGSNYATMRFDPESKHGANNGLNIARDLLEPVKQEFPWISYGDLWTLSGVAAIQELGGPKIPWRPGRVDGVAAQCTPDGRLPDASQGADHVRIFYRMGFNDQEIVALIGGHALGRCHADRSGYEGPWTFSPTSVTNSFYKLLLEEKWVWKKWSGPKQLEDKKTQSLMMLPADYVLVTDKNFKKWVKAYADDEDLWFKDFSASVARLFELGVPTQQFVSAEPWILKNTDEKN

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCGCAGCCCTCAGAGCATCCGCACGCCGTACGACGGCCTCCGCGGCACGTGTGTCGCCCCGCGTCGCAGTGCGCAACGCCGCCGTCCGTCGTTACGCGACCGAGAGTGCGCCT
CCTCCTCCCCCTAAGAGCAGCAACGCCGCTCTCTTCGGTGCTATCGGCGCCGCCGCCCTCGCAGGGGGTGCCTACTACGTCTTCTCCTCCTCCGACTCGGCTACCGAGACCAAGGCGAGC
ATCCACGCGGCCAACTACGTCCCGACCAAGGAGGACTACCAAAAG
GTTAGTGTGTTCCCGTACCTCATCCTTTGTCGTCTCTCCCGAATCTCCGTTGCGTTCTGCAGCGGGGTGGTACAG
GAACGGCCGTGCTGACCGTGCGCCCCCGTAGGTGTACAACCGCGTTGCAGACATCTTCGACAAGGCGGCTGATAAGAACTATGACGGTGCGTGTCGCCCTTCCCCTTCGACCCGATGACC
GGACGTTGTGCGCGTTGCACTCACGCGCCAGGAATTCCTGGTCACTCGCAGATGGCTCGTACGGCCCCGTCATCCTCCGCCTCGCCTGGCACTCGTCGGGCACGTACGACAAGGAGACCG
GGACTGGTGGCAG
GTATGGCTCTCCCACGCCGGTCTCCGGTCATGTTCGCGTCCGCTGACAGTGACATCGTTTGTGGCCCCGTCCCTTTTCCGCGTCGTTTCCAACACTCTTGGGAATGA
TACGTCCACTATCGCGCCGATGTGTGGATGCGCAGCAACTACGCGACGATGCGCTTCGACCCCGAGTCCAAGCACGGCGCGAACAACGGCCTGAACATCGCCCGCGACCTGCTCGAGCCC
GTCAAGCAGGAGTTCCCCTGGATCTCGTACGGCGACCTCTGGACCCTGTCTGGCGTCGCCGCGATCCAGGAGCTTGGTGGGCCCAAGATCCCCTGGCGCCCCGGCCGTGTCGACGGCGTC
GCTGCGCAGTGCACGCCTGACGGCCGTCTCCCGGACGCTTCCCAGGGTGCCGACCACGTCCGCAAC
GTGAGTATCTCCCCCGTAAAGAGATCAAACGTGCGCGACCTTAGCTGACGCATG
CCATGGACCTGCCACGCAGATCTTCTACCGCATGGGGTATGTAATATGCGATGCACGCTGTCCTCCTGTGACGGCGTCCTGACGGCGGACGCTAACCTCTTTGTCTCTGGACAGGTTCAA
CGACCAGGAGATCGTCGCGCTCATCGGTGGCCACGCGCTGGGCCGCTGCCACGCCGACCGCTCGGGCTACGAGGGCCCCTGGACGTTCTCGCCGACGAGCGTGACGAACTCGTTCTACAA
GCTCCTCCTCGAGGAGAAGTGGGTGTGGAAGAAGTGGAGCGGGCCGAAGCAGCTCGAGGACAAGAAGACGCAGAGCCTGATGATGCTCCCCGCAGACTACGTGCTCGTGACGGACAAGAA
CTTCAAGAAGTGGGTCAAGGCGTACGCCGACGACGAGGACCTCTGGTTCAAGGA
GTGCGTCCCCCAGACTATAATTGGCACTCACCGATTGGCTGACGCGCGCGTGGGAATCCTTTGTGT
GCAGCTTCTCTGCGTCGGTGGCGAGGCTGTTTGAGCTCGGCGTGCCCACCCAGCAGTTCGTCTCCGCCGAGCCCTGGATCCTCAAGAACACCGACGAGAAGAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCGCAGCCCTCAGAGCATCCGCACGCCGTACGACGGCCTCCGCGGCACGTGTGTCGCCCCGCGTCGCAGTGCGCAACGCCGCCGTCCGTCGTTACGCGACCGAGAGTGCGCCT
CCTCCTCCCCCTAAGAGCAGCAACGCCGCTCTCTTCGGTGCTATCGGCGCCGCCGCCCTCGCAGGGGGTGCCTACTACGTCTTCTCCTCCTCCGACTCGGCTACCGAGACCAAGGCGAGC
ATCCACGCGGCCAACTACGTCCCGACCAAGGAGGACTACCAAAAG
GTGTACAACCGCGTTGCAGACATCTTCGACAAGGCGGCTGATAAGAACTATGACGATGGCTCGTACGGCCCCGTC
ATCCTCCGCCTCGCCTGGCACTCGTCGGGCACGTACGACAAGGAGACCGGGACTGGTGGCAG
CAACTACGCGACGATGCGCTTCGACCCCGAGTCCAAGCACGGCGCGAACAACGGCCTG
AACATCGCCCGCGACCTGCTCGAGCCCGTCAAGCAGGAGTTCCCCTGGATCTCGTACGGCGACCTCTGGACCCTGTCTGGCGTCGCCGCGATCCAGGAGCTTGGTGGGCCCAAGATCCCC
TGGCGCCCCGGCCGTGTCGACGGCGTCGCTGCGCAGTGCACGCCTGACGGCCGTCTCCCGGACGCTTCCCAGGGTGCCGACCACGTCCGCAAC
ATCTTCTACCGCATGGGGTTCAACGAC
CAGGAGATCGTCGCGCTCATCGGTGGCCACGCGCTGGGCCGCTGCCACGCCGACCGCTCGGGCTACGAGGGCCCCTGGACGTTCTCGCCGACGAGCGTGACGAACTCGTTCTACAAGCTC
CTCCTCGAGGAGAAGTGGGTGTGGAAGAAGTGGAGCGGGCCGAAGCAGCTCGAGGACAAGAAGACGCAGAGCCTGATGATGCTCCCCGCAGACTACGTGCTCGTGACGGACAAGAACTTC
AAGAAGTGGGTCAAGGCGTACGCCGACGACGAGGACCTCTGGTTCAAGGA
CTTCTCTGCGTCGGTGGCGAGGCTGTTTGAGCTCGGCGTGCCCACCCAGCAGTTCGTCTCCGCCGAGCCC
TGGATCCTCAAGAACACCGACGAGAAGAACTGA

Retrieve as FASTA