Entry information : GtraCcP (Glotr-CCP)
Entry ID 10699
Creation 2012-03-05 (Christophe Dunand)
Last sequence changes 2012-03-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: GtraCcP (Glotr-CCP)
Name (synonym) GtraCcP (Glotr-CCP)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Gloeophyllaceae Gloeophyllum
Organism Gloeophyllum trabeum    [TaxId: 104355 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GtraCcP
start..stop
S start..stop
NlepCcP01 682 0 1..378 1..377
JargCcP 583 0 1..367 1..368
AthiCcP01 563 0 1..374 1..370
PoCcP_PC9 555 0 1..376 1..374
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 782179..782481 303 N° 2 782073..782121 49 N° 3 781944..782025 82 N° 4 781736..781889 154
N° 5 781560..781676 117 N° 6 781482..781498 17 N° 7 781362..781427 66 N° 8 781232..781309 78
N° 9 781103..781174 72 N° 10 780959..781042 84 N° 11 780784..780898 115  
complement(join(780784..780898,780959..781042,781103..781174,781232..781309,7813 62..781427,781482..781498,781560..781676,781736..781889,781944..782025,782073..7 82121,782179..782481))


exon

Literature and cross-references GtraCcP (Glotr-CCP)
DNA ref. JGI genome:   scaffold_00004 (782481..780784)
Cluster/Prediction ref. JGI gene:   120395
Protein sequence: GtraCcP (Glotr-CCP)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   380
PWM (Da):   %s   41989.55  
PI (pH):   %s   7.96
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFSLFRAPVCKGAFSAVSAPRSAARIQFRKYASGPSGSSESKTGFWAAIGAGVTIAGGLAYYMTTSNSDTARQAQTAAKSGAQAVKAATNFTPSKDDFQKVYNRIAEVMDEAGDYDDGSYGPIFVRLAWHCSGTYDKASNTGGSNFATMRFEPESLHGGNKGLHIAREVMEGIKKDFPWISYGDLWTLGGVAAIEMQGPKIPWRPGRIDGFQTDCTPDGRLPDGSQGADHLRSIFYRMGFNDQEIVALSGAHALGRCHPDRSGFEGPWTFSPTTVTNDYFKLLFDEKWVWKKWNGPKQFVDKKTGSLMMLPTDYVLTQDKSFRKYAKAYAEDQDLWFKDFSKAFSRLLELGVPESQWATSEPWIMKTLEEQQAESK

Retrieve as FASTA  
Remarks complete sequence from genomic (10 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTCTCACTGTTCAGGGCGCCTGTCTGCAAGGGCGCTTTCTCTGCTGTCTCAGCTCCTAGATCGGCGGCCAGGATTCAATTCCGCAAGTATGCATCGGGACCGTCTGGATCCTCT
GAATCCAAGACTGGTTTCTGGGCAGCTATCGGTGCTGGTGTTACCATTGCAGGAGGCCTGGCGTACTACATGACTACAAGCAATTCAGACACCGCCAGGCAAGCTCAGACTGCTGCCAAG
TCTGGTGCTCAGGCTGTTAAGGCTGCGACCAACTTTACCCCATCCAAGGATGACTTCCAGAAG
GTCCGAAAGGCCCCAACATTAGGATGTCGTTGAAGTGGTACTCATGAGCATTATTAG

GTTTACAACCGGATTGCTGAAGTGATGGACGAGGCTGGTGATTACGATG
GTATGCTCAGTCAGCCCAGTCCTTTACCGACACTAATAATATTCAAGACGGTTCTTACGGTCCCATCTTCG
TTCGTTTGGCATGGCATTGCTCTGGTACTTACGACAAGGCATCGAATACTGGTGGAAG
GTCTGCATCGTCGGCGTAAAGGTTTAAACTGAGACTAACCGCCATACTTTTCAGCAATTTTG
CCACTATGCGCTTCGAGCCTGAATCTCTTCACGGCGGTAACAAGGGTCTCCACATCGCTCGTGAAGTGATGGAAGGTATCAAGAAGGACTTCCCTTGGATCAGCTACGGTGATTTGTGGA
CTCTCGGTGGTGTTGCCGCTATCCAG
GTATATAACTGCCTCAAAGTCAGCAATTGACGGAAAGGACTGACGACCGTCCGGCTTAGGAAATGCAAGGGCCCAAGATCCCCTGGAGGCCCGG
ACGAATTGACGGTTTCCAGACGGACTGCACACCGGACGGTCGCCTCCCCGATGGCTCACAGGGTGCTGACCATTTGCGAAGC
GTTAGTATATCCTTACGGAATGTCCCTGGCTTTCGCTT
ACTAATTTCATTTCACTGGATAGATCTTCTACCGTATGGGGTACGTTCACGCGGCGCCGACTGACCCGAACAGCTAATCCATCCTGTTGTTCAGTTTCAACGACCAGGAAATCGTCGCTC
TCTCTGGTGCTCATGCTCTTGGACGCTGCCACCCAGACCG
GTATGTGATATCGTACGAGGGATAAGCAGTTTAATCACGATACGTCTGCCAGTTCCGGATTTGAAGGCCCTTGGACATTC
TCCCCGACCACCGTGACCAACGACTACTTCAAGCTTCTCTTCGATGAGAA
GTAAGTAGTTACCGCTACAGGTATCACAGCACCGCTAAGCGTGTCATCGCACCTCAGGTGGGTATGGAAA
AAGTGGAACGGCCCCAAGCAATTCGTGGACAAGAAGACCGGATCTCTCATGATGCTGCC
GTGAGTAGTCACTGTTTAAATCCTGTGAAACGCTTAGTTTCTGACGTCCTCAATTTGCAGC
ACGGACTACGTGCTTACTCAGGACAAGAGCTTCAGGAAATACGCCAAGGCTTACGCTGAGGATCAGGACCTGTGGTTCAAAGA
GTGAGTTGACTCCGGCGCATCGAGCGTAGGATTGAAC
CGCTAATCATCTGTCGCCATCAGCTTCTCCAAGGCCTTCTCCAGATTGCTTGAACTTGGCGTGCCCGAGTCCCAGTGGGCCACCTCTGAGCCTTGGATCATGAAGACTCTCGAGGAGCAG
CAGGCGGAGTCCAAGCAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTCTCACTGTTCAGGGCGCCTGTCTGCAAGGGCGCTTTCTCTGCTGTCTCAGCTCCTAGATCGGCGGCCAGGATTCAATTCCGCAAGTATGCATCGGGACCGTCTGGATCCTCT
GAATCCAAGACTGGTTTCTGGGCAGCTATCGGTGCTGGTGTTACCATTGCAGGAGGCCTGGCGTACTACATGACTACAAGCAATTCAGACACCGCCAGGCAAGCTCAGACTGCTGCCAAG
TCTGGTGCTCAGGCTGTTAAGGCTGCGACCAACTTTACCCCATCCAAGGATGACTTCCAGAAG
GTTTACAACCGGATTGCTGAAGTGATGGACGAGGCTGGTGATTACGATGACGGTTCT
TACGGTCCCATCTTCGTTCGTTTGGCATGGCATTGCTCTGGTACTTACGACAAGGCATCGAATACTGGTGGAAG
CAATTTTGCCACTATGCGCTTCGAGCCTGAATCTCTTCACGGCGGT
AACAAGGGTCTCCACATCGCTCGTGAAGTGATGGAAGGTATCAAGAAGGACTTCCCTTGGATCAGCTACGGTGATTTGTGGACTCTCGGTGGTGTTGCCGCTATCCAG
GAAATGCAAGGG
CCCAAGATCCCCTGGAGGCCCGGACGAATTGACGGTTTCCAGACGGACTGCACACCGGACGGTCGCCTCCCCGATGGCTCACAGGGTGCTGACCATTTGCGAAGC
ATCTTCTACCGTATG
GG
TTTCAACGACCAGGAAATCGTCGCTCTCTCTGGTGCTCATGCTCTTGGACGCTGCCACCCAGACCGTTCCGGATTTGAAGGCCCTTGGACATTCTCCCCGACCACCGTGACCAACGAC
TACTTCAAGCTTCTCTTCGATGAGAA
GTGGGTATGGAAAAAGTGGAACGGCCCCAAGCAATTCGTGGACAAGAAGACCGGATCTCTCATGATGCTGCCCACGGACTACGTGCTTACTCAG
GACAAGAGCTTCAGGAAATACGCCAAGGCTTACGCTGAGGATCAGGACCTGTGGTTCAAAGA
CTTCTCCAAGGCCTTCTCCAGATTGCTTGAACTTGGCGTGCCCGAGTCCCAGTGGGCC
ACCTCTGAGCCTTGGATCATGAAGACTCTCGAGGAGCAGCAGGCGGAGTCCAAGCAG

Retrieve as FASTA