Entry information : OsPrx60 (Os04g59150 / OS04G59260)
Entry ID 1070
Creation 2006-06-26 (Filippo Passardi)
Last sequence changes 2010-08-03 (Marie Brette (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-12-21 (Christophe Dunand)
Peroxidase information: OsPrx60 (Os04g59150 / OS04G59260)
Name (synonym) OsPrx60 (Os04g59150 / OS04G59260)
Class Class III peroxidase    [Orthogroup: Prx062]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Inducer Magnaporthe grisea infection
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx60
start..stop
S start..stop
SiPrx88 509 0 2..346 5..350
ZmPrx24 497 2e-178 23..346 26..357
ZmPrx58 490 1e-175 21..346 24..351
SofPrx14 489 2e-175 7..346 16..358
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35223870..35224106 237 N° 2 35223530..35223715 186 N° 3 35222817..35223434 618  
complement(join(35222817..35223434,35223530..35223715,35223870..35224106))


exon

Literature and cross-references OsPrx60 (Os04g59150 / OS04G59260)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1N4
DNA ref. GenBank:   NC_008397.1 (35224106..35222820)
Protein sequence: OsPrx60 (Os04g59150 / OS04G59260)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   346 (324)
PWM (Da):   %s   36893.7 (34690.5)  
PI (pH):   %s   6.04 (5.39) Peptide Signal:   %s   cut: 23 range:23-346
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASKLGMVVLLISGLFAARCAAVVTTGEPVVAGLSWGFYDTSCPSVEGIVRWHVTEALRRDIGIAAGLVRIFFHDCFPQGCDASVLLTGSQSELGEIPNQTLRPSALKLIEDIRAAVHSACGAKVSCADITTLATRDAIVASGGPYFDVPLGRRDGLAPASSDKVGLLPAPFFDVPTLIQAFKDRNLDKTDLVALSGAHTIGLGHCGSFNDRFDGSKPIMDPVLVKKLQAKCAKDVPVNSVTQELDVRTPNAFDNKYYFDLIAKQGIFKSDQGLIEDAQTNRTAVRFALNQAAFFDQFARSMVKMSQMDVLTGNAGEIRNNCAAPNRRSSDLLNAADDDQGFAADA*

Retrieve as FASTA  
Remarks Complete sequence from DNA (chromo 4, intron 1) and 71 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCCAAGCTGGGTATGGTTGTGCTACTGATCTCGGGCCTCTTTGCTGCCCGTTGCGCGGCCGTGGTGACCACCGGCGAACCCGTCGTCGCCGGCCTCTCCTGGGGGTTCTATGAC
ACGTCGTGCCCGTCGGTGGAGGGCATCGTGAGGTGGCACGTCACCGAGGCCCTCCGCCGCGACATCGGCATCGCCGCCGGCCTCGTCCGCATCTTCTTCCACGACTGCTTCCCGCAG
GCA
CGTCCTACTACCATTTTACTCCAGTAGTTGCCGGTTCGGTTGATGCATGGTGCCTCCTTCTTACAGATGGCAATACATAAAAAAAAAACAAATTAAATACCGAGTTTTAGTAACTACAGT
AGTATATTAACATAATTAATTAAGTGTTCAGGGGTGCGACGCGTCGGTCCTCCTGACGGGTTCCCAAAGCGAGCTGGGTGAGATACCCAACCAGACGCTGCGGCCGTCGGCGCTGAAGCT
CATCGAGGACATCCGCGCCGCCGTACACTCCGCCTGCGGCGCCAAGGTGTCCTGCGCCGACATCACCACGCTCGCCACGCGTGACGCCATCGTCGCC
GTACGTCTAATTCTTAATTAATA
ATGAACAGTCGGGATTTTTACTCAAGAACTGAACAAATTAACATATTTAATTTAATTACATTTACATGGCAGTCCGGCGGGCCCTACTTCGACGTGCCTCTGGGGCGGCGCGACGGGCTG
GCACCGGCGTCGAGCGACAAGGTGGGCCTCCTGCCGGCGCCCTTCTTCGACGTGCCCACGCTCATCCAGGCGTTCAAGGACCGAAACCTGGACAAGACGGACCTGGTGGCGCTGTCCGGC
GCGCACACCATCGGACTAGGCCACTGCGGCAGCTTCAACGACCGCTTCGATGGCTCCAAGCCCATCATGGACCCTGTGCTGGTGAAGAAGCTGCAGGCCAAGTGCGCCAAGGACGTGCCG
GTGAACTCGGTCACGCAGGAGCTGGACGTCCGCACGCCCAACGCCTTCGACAACAAGTACTACTTCGACCTCATCGCCAAGCAGGGGATCTTCAAGTCCGACCAGGGCCTCATCGAGGAC
GCGCAGACCAACCGCACCGCCGTCCGCTTCGCCCTCAACCAGGCCGCCTTCTTCGACCAGTTCGCACGCTCCATGGTCAAGATGAGCCAGATGGACGTCCTCACCGGCAACGCCGGCGAG
ATCCGCAACAACTGCGCCGCTCCCAACCGCCGCTCCTCCGACCTCCTCAACGCTGCCGACGACGACCAAGGCTTCGCCGCCGACGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCCAAGCTGGGTATGGTTGTGCTACTGATCTCGGGCCTCTTTGCTGCCCGTTGCGCGGCCGTGGTGACCACCGGCGAACCCGTCGTCGCCGGCCTCTCCTGGGGGTTCTATGAC
ACGTCGTGCCCGTCGGTGGAGGGCATCGTGAGGTGGCACGTCACCGAGGCCCTCCGCCGCGACATCGGCATCGCCGCCGGCCTCGTCCGCATCTTCTTCCACGACTGCTTCCCGCAG
GGG
TGCGACGCGTCGGTCCTCCTGACGGGTTCCCAAAGCGAGCTGGGTGAGATACCCAACCAGACGCTGCGGCCGTCGGCGCTGAAGCTCATCGAGGACATCCGCGCCGCCGTACACTCCGCC
TGCGGCGCCAAGGTGTCCTGCGCCGACATCACCACGCTCGCCACGCGTGACGCCATCGTCGCC
TCCGGCGGGCCCTACTTCGACGTGCCTCTGGGGCGGCGCGACGGGCTGGCACCGGCG
TCGAGCGACAAGGTGGGCCTCCTGCCGGCGCCCTTCTTCGACGTGCCCACGCTCATCCAGGCGTTCAAGGACCGAAACCTGGACAAGACGGACCTGGTGGCGCTGTCCGGCGCGCACACC
ATCGGACTAGGCCACTGCGGCAGCTTCAACGACCGCTTCGATGGCTCCAAGCCCATCATGGACCCTGTGCTGGTGAAGAAGCTGCAGGCCAAGTGCGCCAAGGACGTGCCGGTGAACTCG
GTCACGCAGGAGCTGGACGTCCGCACGCCCAACGCCTTCGACAACAAGTACTACTTCGACCTCATCGCCAAGCAGGGGATCTTCAAGTCCGACCAGGGCCTCATCGAGGACGCGCAGACC
AACCGCACCGCCGTCCGCTTCGCCCTCAACCAGGCCGCCTTCTTCGACCAGTTCGCACGCTCCATGGTCAAGATGAGCCAGATGGACGTCCTCACCGGCAACGCCGGCGAGATCCGCAAC
AACTGCGCCGCTCCCAACCGCCGCTCCTCCGACCTCCTCAACGCTGCCGACGACGACCAAGGCTTCGCCGCCGACGCCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCAG CGAGCAGGAG ACTGGCCGTC CTGGAGCTCG TCTCCATCGT CGCCGTCCTC CTCATCTCCT CACCAGCAGC AGCAGCAGAG TTGTCCGTGG ACTTCCACGC GGCGTCGTGC  CCGCAGCTGG AGTCCATCGT GCGCTCCTCC GTGCAAGCCG CTCTCCAGCA GGAGATCGCC CTCGCCGCCG GCCTCCTCCG CATCTTCTTC CACGACTGCT TCCCGCAGGG GTGCGATGCG  TCGGTGTATC TGAGAGGAGG CAGCAACTCG GAGCAGGGCA TGGGCCCAAA CCTCACGCTG CAGCCGCGGG CGCTGCAGCT GGTGGAGGAC ATCCGCGCCA AGGTGCACGC CGCCTGCGGC  CCCACCGTCT CCTGCGCCGA CATCTCCGCC CTCGCCACCC GCGACGCTGT CGTCGTCTCC GGCGGCCCCT CTTACGCCGT GCCACTCGGC CAAAAAGACA GCCTCGCTCC GGCATCGTTG  GACCTCGTCG GAGATCTCCC GGGCCCGGGC ACCTCCAGAG TCCAGGATCT CATCGACCTT TTTGCAAGCA GGGGACTGCG GGACGCCGCC GACCTGGTGG CGCTCTCCGG CGGGCACACC  GTCGGGAGGA CACGCTGCGC CTTCTTCGAT GACCGCGCCC GCCGCCAGGA CGACACCTTC TCCAAGAAGC TGGCGTTGAA CTGCACCAAG GACCCCAACC GGCTGCAGAA CCTGGACGTG  ATCACCCCCG ACGCCTTCGA CAACGCCTAC TACATCGCGC TCATCCACAA CCAGGGCGTC TTCACCTCCG ACATGGCGCT CATCAAGGAC CGGATCACGG CGCCCATCGT CAGGCAGTTC  GCCACGGACA AGGCCGCCTT CTTCACGCAG TTCGCCAAGT CCATGGTCAA ACTAAGCAAT GTGCCGAGGA CTGACAGGAA CGTCGGCGAG ATCCGCCGCA GCTGCTTCAG GACCAACAGC 
CAGAGCCTCG TCGACTTCGC CACCAGCGAT GAGGAGGGCT TCGCTGCTTC TGCTTGA 

Retrieve as FASTA