Entry information : HcyCcP
Entry ID 10700
Creation 2012-03-05 (Christophe Dunand)
Last sequence changes 2012-03-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: HcyCcP
Name HcyCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Hebeloma
Organism Hebeloma cylindrosporum    [TaxId: 76867 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HcyCcP
start..stop
S start..stop
GmarCcP 614 0 1..386 1..384
HsubCcP 602 0 1..387 1..378
PoCcP_PC9 591 0 22..383 11..375
PoCcP_PC15 576 0 22..373 11..365
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1180139..1180459 321 N° 2 1180511..1180559 49 N° 3 1180611..1180692 82 N° 4 1180751..1180904 154
N° 5 1180960..1181093 134 N° 6 1181154..1181369 216 N° 7 1181436..1181519 84 N° 8 1181581..1181704 124
join(1180139..1180459,1180511..1180559,1180611..1180692,1180751..1180904,1180960 ..1181093,1181154..1181369,1181436..1181519,1181581..1181704)


exon

Literature and cross-references HcyCcP
DNA ref. JGI genome:   scaffold_4 (1180139..1181704)
Cluster/Prediction ref. JGI gene:   464154
Protein sequence: HcyCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   388
PWM (Da):   %s   42976.63  
PI (pH):   %s   9.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFSVFRTSLRSARAANPLLQRRAAQLPKAQFRAAFNRKFSTPPPGPGAKSSNTTLYLGLGAAAAGGLAYYFYNTDGGKEAGTAVRSGAQAAKVAANFVPTKDDYTKVYNAIVKIMDEAGEYDDGSYGPVLLRLAWHSSGTYDKDSKTGGSNYATMRFEPEAKHGANNGLNVARDLMEKVKQQFPWISYGDLWTLAGVAAIEMAGPHIPWRPGRIDGFAAQATPDGRLPDATQGADHLRNIFYRMGFNDQEIVALSGAHALGRAHKDRSGFDGPWTFSPTTLTNDFYKLLFDEKWVWKRWDGPKQLEDKKTKSLMMLPTDYVLVTDKSFKKYAKSYADNQDLWFKDFSKAVATLFELGVPTEQFVTPEPWIMPTVEEQEAKKEEKK

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCAGCGTATTCCGCACCTCTCTGCGCAGCGCACGGGCGGCCAACCCTTTGCTGCAGCGTCGCGCGGCCCAGCTGCCCAAAGCCCAGTTCCGCGCGGCGTTCAACCGCAAGTTC
TCGACTCCCCCACCTGGCCCCGGGGCCAAGTCGTCGAACACCACTCTGTACCTTGGTCTTGGGGCGGCTGCAGCTGGTGGTCTTGCTTACTATTTCTACAACACCGACGGGGGGAAGGAG
GCTGGGACTGCCGTTAGGTCGGGTGCTCAGGCTGCGAAGGTCGCGGCCAACTTCGTCCCCACCAAGGATGACTACACCAAG
GTAGGTCGATTCCCAAGGTTGTTCCTGTGATCTTATTCG
ATGTGATTACAGGTCTACAATGCGATTGTTAAAATCATGGACGAAGCTGGCGAATACGATGGTAGGTAACCTGCATACTCATGCTTTACCTCGTGTTGACGGTTTTCATCAGATGGGTCT
TATGGACCTGTTCTCCTCCGCCTTGCCTGGCACTCTTCGGGAACTTACGACAAGGACTCGAAGACTGGTGGCAG
GTCCGTAGCTTACCCGGACTCTCCCCTATTCCTGTCGTTAGGCTGA
CCTGTTCCCCAGCAACTACGCTACTATGCGCTTCGAGCCAGAAGCTAAGCACGGTGCCAACAACGGTTTGAACGTCGCTCGTGACCTGATGGAAAAAGTCAAACAACAATTCCCATGGAT
TAGCTACGGTGACCTCTGGACTCTCGCTGGCGTTGCTGCTATTCAG
GTGCGTGTTGCTGTCAGTTTATCTCTAAATTCCTGGCTCACACCACGCTTATTAGGAAATGGCTGGACCTCACA
TCCCCTGGCGCCCAGGACGTATCGACGGATTCGCTGCTCAGGCGACCCCAGATGGCCGTCTCCCGGATGCTACACAAGGTGCTGACCATCTTAGGAATATCTTCTACCGCATGGG
GTTCG
TTGCGTTGTTTTCTCTGAACGAGTCGTATCTGTAAACTAACTTTCTGTATATCAGCTTCAACGACCAGGAAATCGTCGCTCTCTCTGGGGCACATGCTCTTGGACGTGCCCATAAAGATC
GCTCTGGATTCGACGGCCCGTGGACTTTCTCTCCTACAACCTTGACTAACGATTTCTACAAACTCTTGTTCGACGAGAAGTGGGTATGGAAGCGCTGGGATGGACCTAAGCAACTCGAGG
ATAAGAAGACTAAGTCTTTGATGATGTTGCC
GTGAGTGATATGCTCGTCGTCATATTTATCTTCTTGAAATCTGATTCTATTCTGTTATTCTCTTAGCACCGACTACGTTCTCGTCACCG
ACAAGTCCTTCAAGAAGTACGCCAAGAGTTACGCTGATAACCAGGATTTGTGGTTCAAGGA
GTTCGCCATTTCGAAAATCCTTGTCTTTCTGTCATCGGCTTACCATTCACTTCGCTTTT
AGTTTCTCCAAGGCTGTTGCCACTCTTTTCGAGCTCGGTGTGCCCACAGAGCAATTTGTCACCCCCGAGCCCTGGATTATGCCCACCGTTGAGGAACAAGAGGCGAAGAAGGAAGAGAAG
AAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCAGCGTATTCCGCACCTCTCTGCGCAGCGCACGGGCGGCCAACCCTTTGCTGCAGCGTCGCGCGGCCCAGCTGCCCAAAGCCCAGTTCCGCGCGGCGTTCAACCGCAAGTTC
TCGACTCCCCCACCTGGCCCCGGGGCCAAGTCGTCGAACACCACTCTGTACCTTGGTCTTGGGGCGGCTGCAGCTGGTGGTCTTGCTTACTATTTCTACAACACCGACGGGGGGAAGGAG
GCTGGGACTGCCGTTAGGTCGGGTGCTCAGGCTGCGAAGGTCGCGGCCAACTTCGTCCCCACCAAGGATGACTACACCAAG
GTCTACAATGCGATTGTTAAAATCATGGACGAAGCTGGC
GAATACGATG
ATGGGTCTTATGGACCTGTTCTCCTCCGCCTTGCCTGGCACTCTTCGGGAACTTACGACAAGGACTCGAAGACTGGTGGCAGCAACTACGCTACTATGCGCTTCGAGCCA
GAAGCTAAGCACGGTGCCAACAACGGTTTGAACGTCGCTCGTGACCTGATGGAAAAAGTCAAACAACAATTCCCATGGATTAGCTACGGTGACCTCTGGACTCTCGCTGGCGTTGCTGCT
ATTCAG
GAAATGGCTGGACCTCACATCCCCTGGCGCCCAGGACGTATCGACGGATTCGCTGCTCAGGCGACCCCAGATGGCCGTCTCCCGGATGCTACACAAGGTGCTGACCATCTTAGG
AATATCTTCTACCGCATGGG
CTTCAACGACCAGGAAATCGTCGCTCTCTCTGGGGCACATGCTCTTGGACGTGCCCATAAAGATCGCTCTGGATTCGACGGCCCGTGGACTTTCTCTCCT
ACAACCTTGACTAACGATTTCTACAAACTCTTGTTCGACGAGAAGTGGGTATGGAAGCGCTGGGATGGACCTAAGCAACTCGAGGATAAGAAGACTAAGTCTTTGATGATGTTGCC
CACC
GACTACGTTCTCGTCACCGACAAGTCCTTCAAGAAGTACGCCAAGAGTTACGCTGATAACCAGGATTTGTGGTTCAAGGA
TTTCTCCAAGGCTGTTGCCACTCTTTTCGAGCTCGGTGTG
CCCACAGAGCAATTTGTCACCCCCGAGCCCTGGATTATGCCCACCGTTGAGGAACAAGAGGCGAAGAAGGAAGAGAAGAAGTAA

Retrieve as FASTA