Entry information : JargCcP
Entry ID 10702
Creation 2012-03-05 (Christophe Dunand)
Last sequence changes 2012-03-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: JargCcP
Name JargCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Jaapiaceae Jaapia
Organism Jaapia argillacea    [TaxId: 202697 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value JargCcP
start..stop
S start..stop
GtraCcP 593 0 1..375 1..374
NlepCcP01 580 0 1..376 1..375
PoCcP_PC9 578 0 1..375 1..372
SlacCcP01 566 0 1..375 1..371
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 489162..489467 306 N° 2 489059..489107 49 N° 3 488927..489008 82 N° 4 488713..488866 154
N° 5 488540..488656 117 N° 6 488467..488483 17 N° 7 488346..488411 66 N° 8 488210..488287 78
N° 9 488073..488144 72 N° 10 487916..487999 84 N° 11 487725..487833 109  
complement(join(487725..487833,487916..487999,488073..488144,488210..488287,4883 46..488411,488467..488483,488540..488656,488713..488866,488927..489008,489059..4 89107,489162..489467))


exon

Literature and cross-references JargCcP
DNA ref. JGI genome:   scaffold_16 (489467..487725)
Cluster/Prediction ref. JGI gene:   37172
Protein sequence: JargCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   378
PWM (Da):   %s   41796.8  
PI (pH):   %s   7.05
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFSMLRAPVCKAAFSTPSVSQFALRNQFRRFATGPASSEPVKSGGKSWLIGGGLLAFGGVGYYLYSTNPDLFKEAGTAAKSSVQAAKVATKFTPAQEDYQKVYNKIVQLVEDAGDYDDGSYGPVLVRLAWHASGTYDKETGTGGSNYATMRFEPEAKHGANNGLNIARDIMEGVKKEFPWISYGDLWTLGGVCAIEMSGPKIPWRPGRIDGFATEATPDGRLPDASQGADHLRSIFYRMGFNDQEIVALSGAHALGRCHTDRSGFDGPWTFSPTTVTNDYFKLLFDERWIWKKWSGPKQLVDKKTGTLMMLPTDYVLTQDKSFKKFAKAYADDQDLWFKDFSKAVSTLFELGVPTQQFVSSEPWILKTKEEQEEK

Retrieve as FASTA  
Remarks Complete sequence from genomic (10 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTCTCCATGCTCCGAGCTCCTGTTTGCAAGGCCGCTTTTTCTACGCCCAGCGTCTCTCAGTTCGCTCTGCGCAACCAGTTCCGTAGATTTGCGACTGGACCTGCTTCCTCCGAG
CCCGTGAAATCTGGGGGCAAGTCTTGGTTGATTGGAGGGGGGTTATTGGCCTTTGGTGGTGTTGGGTATTATCTTTACTCCACCAATCCCGACTTGTTCAAGGAGGCGGGTACTGCTGCC
AAGTCGAGTGTTCAGGCTGCGAAAGTGGCTACGAAATTCACTCCCGCTCAAGAGGACTACCAGAAG
GTTCGGACGACTTTGTCCGATATGCCTGGCGACACGAGCTGATAAAACTTCCAG

GTGTATAACAAGATCGTTCAGCTTGTTGAGGACGCTGGCGATTACGATG
GTACGTCGAGTGCATTTTACCCTCCGGAAGACAACTAACAAAGACACTAGACGGCTCTTATGGTCCCGTGC
TCGTCCGCTTGGCCTGGCACGCCTCTGGTACTTACGACAAGGAAACTGGCACTGGTGGAAG
GTATGCCTCATAATCTCTGCTCCTAACATGTTACACTATCTTATCGCTTGCCTCTTGTA
GCAACTACGCAACTATGCGTTTCGAACCCGAAGCTAAACATGGTGCTAACAACGGCTTGAACATCGCTCGCGACATCATGGAAGGCGTCAAGAAGGAATTCCCTTGGATTAGCTATGGTG
ACCTTTGGACTCTCGGCGGTGTTTGCGCTATTCAG
GTGACTTCTGTCCCCAACTATCTCGTATCATCTAGTTCTGATGTATCTTTTCGTAGGAAATGTCAGGACCTAAGATCCCTTGGAG
ACCTGGACGAATTGACGGTTTCGCTACTGAAGCTACCCCCGATGGTCGTCTTCCCGACGCTTCCCAAGGCGCTGACCATCTCAGGAGT
GTAAGCAATTCACCTCATATTCCCCTAATACC
AACTCAACACCCCCTTTCCTTCAGATCTTCTACCGCATGGGGTTCGTTCTCCCCGTATTTCGTCAACGAATAATGGTACTAAGAAAGAACACCTAGCTTCAACGACCAAGAAATCGTCGC
TCTCTCAGGCGCTCACGCTCTCGGACGTTGCCACACTGACAG
GTGGGCATCATCTATCTTCGCGATCCCCGTCAAAGACTGATGATCCCTACCTTTTAAGATCTGGATTTGATGGACCCT
GGACTTTCTCGCCTACCACCGTGACTAACGATTACTTCAAACTCCTTTTCGACGAGAG
GTACCTTGTTTTAGTCTTGTCATAGTACGCTGCGCGCTCTAGGTGTTGATGGTTTCGGTGTG
CAGGTGGATCTGGAAGAAATGGAGCGGCCCTAAACAACTTGTGGATAAGAAGACTGGTACTTTGATGATGTTGCCGTGCGTCACGCTTTTCGTATTCTCCTACCTGTGCTGCGTTGTTAA
CTCGAAATGCATCGTCGTTGCACTCTAGTACCGACTACGTACTCACCCAGGACAAGAGCTTCAAGAAATTTGCCAAGGCCTACGCAGATGACCAAGACCTCTGGTTCAAGGAGTACGTCC
ACTCTCTTACCCTTACTCCCTTCATTCCCTTTCCACACTAAATACATACTGACCATCCTCCGCCTCCTTATTAGCTTCTCCAAAGCCGTCTCCACCCTCTTCGAACTTGGCGTCCCCACT
CAACAATTCGTCTCTTCCGAGCCTTGGATCTTAAAGACGAAGGAGGAACAAGAAGAGAAATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTCTCCATGCTCCGAGCTCCTGTTTGCAAGGCCGCTTTTTCTACGCCCAGCGTCTCTCAGTTCGCTCTGCGCAACCAGTTCCGTAGATTTGCGACTGGACCTGCTTCCTCCGAG
CCCGTGAAATCTGGGGGCAAGTCTTGGTTGATTGGAGGGGGGTTATTGGCCTTTGGTGGTGTTGGGTATTATCTTTACTCCACCAATCCCGACTTGTTCAAGGAGGCGGGTACTGCTGCC
AAGTCGAGTGTTCAGGCTGCGAAAGTGGCTACGAAATTCACTCCCGCTCAAGAGGACTACCAGAAG
GTGTATAACAAGATCGTTCAGCTTGTTGAGGACGCTGGCGATTACGATGACGGC
TCTTATGGTCCCGTGCTCGTCCGCTTGGCCTGGCACGCCTCTGGTACTTACGACAAGGAAACTGGCACTGGTGGAAG
CAACTACGCAACTATGCGTTTCGAACCCGAAGCTAAACATGGT
GCTAACAACGGCTTGAACATCGCTCGCGACATCATGGAAGGCGTCAAGAAGGAATTCCCTTGGATTAGCTATGGTGACCTTTGGACTCTCGGCGGTGTTTGCGCTATTCAG
GAAATGTCA
GGACCTAAGATCCCTTGGAGACCTGGACGAATTGACGGTTTCGCTACTGAAGCTACCCCCGATGGTCGTCTTCCCGACGCTTCCCAAGGCGCTGACCATCTCAGGAGT
ATCTTCTACCGC
ATGGG
CTTCAACGACCAAGAAATCGTCGCTCTCTCAGGCGCTCACGCTCTCGGACGTTGCCACACTGACAGATCTGGATTTGATGGACCCTGGACTTTCTCGCCTACCACCGTGACTAAC
GATTACTTCAAACTCCTTTTCGACGAGAG
GTGGATCTGGAAGAAATGGAGCGGCCCTAAACAACTTGTGGATAAGAAGACTGGTACTTTGATGATGTTGCCTACCGACTACGTACTCACC
CAGGACAAGAGCTTCAAGAAATTTGCCAAGGCCTACGCAGATGACCAAGACCTCTGGTTCAAGGA
CTTCTCCAAAGCCGTCTCCACCCTCTTCGAACTTGGCGTCCCCACTCAACAATTC
GTCTCTTCCGAGCCTTGGATCTTAAAGACGAAGGAGGAACAAGAAGAGAAATAG

Retrieve as FASTA