Entry information : GmarDyPrx01
Entry ID 10703
Creation 2012-03-06 (Christophe Dunand)
Last sequence changes 2012-03-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarDyPrx01
Name GmarDyPrx01
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarDyPrx01
start..stop
S start..stop
HcyDyPrx02 753 0 6..486 12..486
HsubDyPrx02 707 0 1..486 1..489
HsubDyPrx01 661 0 2..484 3..489
LbiDyPrx01 636 0 3..484 22..500
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 355632..355687 56 N° 2 355749..355968 220 N° 3 356024..356331 308 N° 4 356385..356698 314
N° 5 356757..356817 61 N° 6 356877..357157 281 N° 7 357213..357267 55 N° 8 357329..357494 166
join(355632..355687,355749..355968,356024..356331,356385..356698,356757..356817, 356877..357157,357213..357267,357329..357494)


exon

Literature and cross-references GmarDyPrx01
DNA ref. JGI genome:   scaffold_21 (355632..357494)
Cluster/Prediction ref. JGI gene:   252241
Protein sequence: GmarDyPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   487
PWM (Da):   %s   52940.37  
PI (pH):   %s   5.99
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSTPSPPLDLNNIQGDILSGLPKKTQVYVFFNVVNVGKFRSDLKKFVPLVKTVAEVLKDRDDIADHKKKKLPGLLPIVGVNIAFSHKGFVKLGIDDSTLAPKGADDPFQLGQQKDAVKNLNDPVKSDGNPDWDSHFLQDIHGLIIISGDTHLSIEKKKLEIELLFGVPTPLASIKEVISIVGDVRPGDESGHEHFGFLDGISNPVVNGFDTVINPGPKTVDPGVVLTGHPGNPGDPITRAPWATDGSFLVFRWLFQQVPEFNEFLKAHPIAKDGNGKVLTPEEGSDLLGARMVGRWKSGAPIDIAPFQDDPALGVDPTRNNDFAFTGEINSQLRCPFAAHVRKTNPRNDLEVPPSPIPPIPVEGRRIMRRGVQFGPELTKDENTSGKTQHSRGLLFTCYQSNITNGFQFLQQSWANNDKFPPFETQPEDPGLDPLIGQGTRAMSGLDPNAEQTVLGMPTFIIPRGGEYFFSPSLKGLKETIAATA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCCACACCTTCACCTCCTCTTGATCTCAACAACATTCAGGGAGATATCCTGTGGGTGTTTCTTCAATTTTAAACGATGCCTCGCTCATCTTCGTTGCTTTGACCTTCGCAGGAG
CGGTCTCCCAAAGAAGACCCAAGTCTACGTATTTTTCAACGTCGTTAATGTCGGAAAATTCAGGTCGGACCTCAAGAAATTCGTCCCACTCGTGAAAACCGTCGCCGAAGTATTAAAGGA
CCGCGATGACATTGCTGACCACAAGAAGAAGAAACTCCCTGGCCTCCTTCCGATAGTCGGCGTGAACATTGCCTTTTCTCACAAAGGATTTGTTAAG
GTTAGTGCAAGTTTACTGGCAGG
TATCCGAGTTGCTCACCAGCCTCTTGATGCAGCTCGGAATTGATGATAGTACCCTGGCTCCGAAAGGCGCAGACGACCCTTTCCAGCTCGGTCAGCAGAAAGATGCAGTAAAGAACCTTA
ATGACCCCGTGAAGAGCGACGGAAACCCCGACTGGGATAGTCATTTCCTCCAAGATATTCATGGGTTGATCATCATTTCCGGGGACACCCACCTCTCGATCGAGAAGAAGAAACTCGAGA
TCGAACTGCTTTTCGGAGTCCCTACTCCATTGGCATCCATCAAAGAAGTGATTAGCATCGTAGGCGACGTACGACCAGGGGACGAATCTGGTCATGAACA
GTAAGGCATTACTTGAGTTC
CTTCGAATAGATATACTCATCTTGTTCCAATAGCTTCGGCTTTTTGGATGGAATCTCCAACCCTGTTGTTAATGGGTTCGACACGGTCATTAACCCGGGCCCGAAAACGGTTGACCCAGG
AGTGGTTCTTACAGGTCATCCTGGTAATCCGGGAGACCCCATCACTAGGGCACCTTGGGCTACCGATGGCAGTTTCCTTGTTTTCCGTTGGCTCTTCCAACAAGTGCCAGAATTCAACGA
ATTCTTGAAGGCTCATCCCATCGCCAAGGATGGAAACGGAAAGGTGTTAACCCCAGAAGAAGGCAGTGATCTGCTTGGGGCAAGAATGGTCGGACGCTGGAAGAGTG
GTGGGTAACCTTT
TCCTTTTTCAATAATTTATGGTTCTGATTTGAAACCGACACGCAGGTGCTCCGATTGATATCGCGCCTTTCCAAGATGACCCTGCTCTTGGGGTTGATCCAACAAGGTACGTGCCCAAAT
ATCGGCCAGAATCGTCCCGTAGAGCCGACTGTTTTCTGCGTGTAGAAACAACGACTTCGCGTTCACTGGAGAGATCAACTCTCAGCTCCGCTGCCCATTCGCTGCCCATGTTCGAAAGAC
TAACCCAAGGAACGACCTTGAAGTGCCTCCTTCGCCTATCCCACCCATTCCGGTTGAAGGCAGACGCATCATGCGCAGAGGAGTTCAATTCGGACCTGAATTAACCAAGGACGAGAATAC
TTCAGGAAAGACGCAGCACAGCAGAGGTTTACTATTCACCTGCTATCAGAGCAACATCACGAATGGCTTCCAGTTCCTCCAGCAAT
GTCAGTTATTCGAGTCTACCTCATAGTGTGGTTG
AATGCTGATCTAAAATTGTAGCGTGGGCGAATAACGACAAATTCCCTCCGTTCGAAACCCAACCAGAGGACCCTGGGTTCGTATTGAGTTTCGCCTTAGTGAAGAGAAATGAAAGCTGAT
AGCGAGCTTTTCGTTAGATTGGACCCACTTATTGGTCAAGGAACTCGTGCAATGTCCGGACTTGACCCAAACGCAGAGCAGACCGTTTTGGGGATGCCCACATTCATTATTCCTCGTGGT
GGAGAATACTTCTTCTCTCCGTCCTTGAAGGGATTGAAAGAGACCATTGCGGCCACTGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCCACACCTTCACCTCCTCTTGATCTCAACAACATTCAGGGAGATATCCTGAGCGGTCTCCCAAAGAAGACCCAAGTCTACGTATTTTTCAACGTCGTTAATGTCGGAAAATTC
AGGTCGGACCTCAAGAAATTCGTCCCACTCGTGAAAACCGTCGCCGAAGTATTAAAGGACCGCGATGACATTGCTGACCACAAGAAGAAGAAACTCCCTGGCCTCCTTCCGATAGTCGGC
GTGAACATTGCCTTTTCTCACAAAGGATTTGTTAAG
CTCGGAATTGATGATAGTACCCTGGCTCCGAAAGGCGCAGACGACCCTTTCCAGCTCGGTCAGCAGAAAGATGCAGTAAAGAAC
CTTAATGACCCCGTGAAGAGCGACGGAAACCCCGACTGGGATAGTCATTTCCTCCAAGATATTCATGGGTTGATCATCATTTCCGGGGACACCCACCTCTCGATCGAGAAGAAGAAACTC
GAGATCGAACTGCTTTTCGGAGTCCCTACTCCATTGGCATCCATCAAAGAAGTGATTAGCATCGTAGGCGACGTACGACCAGGGGACGAATCTGGTCATGAACA
CTTCGGCTTTTTGGAT
GGAATCTCCAACCCTGTTGTTAATGGGTTCGACACGGTCATTAACCCGGGCCCGAAAACGGTTGACCCAGGAGTGGTTCTTACAGGTCATCCTGGTAATCCGGGAGACCCCATCACTAGG
GCACCTTGGGCTACCGATGGCAGTTTCCTTGTTTTCCGTTGGCTCTTCCAACAAGTGCCAGAATTCAACGAATTCTTGAAGGCTCATCCCATCGCCAAGGATGGAAACGGAAAGGTGTTA
ACCCCAGAAGAAGGCAGTGATCTGCTTGGGGCAAGAATGGTCGGACGCTGGAAGAGTG
GTGCTCCGATTGATATCGCGCCTTTCCAAGATGACCCTGCTCTTGGGGTTGATCCAACAAGA
AACAACGACTTCGCGTTCACTGGAGAGATCAACTCTCAGCTCCGCTGCCCATTCGCTGCCCATGTTCGAAAGACTAACCCAAGGAACGACCTTGAAGTGCCTCCTTCGCCTATCCCACCC
ATTCCGGTTGAAGGCAGACGCATCATGCGCAGAGGAGTTCAATTCGGACCTGAATTAACCAAGGACGAGAATACTTCAGGAAAGACGCAGCACAGCAGAGGTTTACTATTCACCTGCTAT
CAGAGCAACATCACGAATGGCTTCCAGTTCCTCCAGCAAT
CGTGGGCGAATAACGACAAATTCCCTCCGTTCGAAACCCAACCAGAGGACCCTGGATTGGACCCACTTATTGGTCAAGGA
ACTCGTGCAATGTCCGGACTTGACCCAAACGCAGAGCAGACCGTTTTGGGGATGCCCACATTCATTATTCCTCGTGGTGGAGAATACTTCTTCTCTCCGTCCTTGAAGGGATTGAAAGAG
ACCATTGCGGCCACTGCCTGA

Retrieve as FASTA