Entry information : GmarDyPrx03
Entry ID 10705
Creation 2012-03-06 (Christophe Dunand)
Last sequence changes 2012-03-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarDyPrx03
Name GmarDyPrx03
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarDyPrx03
start..stop
S start..stop
GmarDyPrx04 844 0 1..501 1..510
GmarDyPrx02 766 0 25..501 27..499
HcyDyPrx01 671 0 26..501 24..501
AthiDyPrx01 575 0 27..501 5..471
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 600832..600941 110 N° 2 600530..600773 244 N° 3 600167..600471 305 N° 4 599805..600103 299
N° 5 599690..599750 61 N° 6 599369..599634 266 N° 7 599256..599310 55 N° 8 599036..599201 166
complement(join(599036..599201,599256..599310,599369..599634,599690..599750,5998 05..600103,600167..600471,600530..600773,600832..600941))


exon

Literature and cross-references GmarDyPrx03
DNA ref. JGI genome:   scaffold_26 (600941..599036)
Cluster/Prediction ref. JGI gene:   159433
Protein sequence: GmarDyPrx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   502
PWM (Da):   %s   55288.57  
PI (pH):   %s   6.81
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATQQPLPPVTLPPPTPPNPAPTPVSLKLENIQGDILSGLPKKTETLYFFQITDAVKFRKDLKKFIPLVKSVAQVLKDREEIEKHKRDHHASVLHGFRPILIPLVGVNISFSHFGFKKLGIDDTKLIDTAFLDGQRFDAGANLGDKGSGSGQDFVPDWEEPFKKEIHGVIILAGDSHPSVDKKLQEIKRIFDVGGRTSSISEITSVQGDARPGDQSAHEHFGYLDGVSNPAIIGFDTNPPPGPAPVRAGAIILGQDGDESKTERAPWMVDGSFLVFRYLFQKVPEFDDFVFRNRLKGPGMSDKEGADLLGARLIGRWKSGAPVDLSPFQDDPELGADPQRNNNFHFSAELNFQKLCPFAAHIRKTLPRADLESRRISIERNRIMRRGIQFGPEVTRAEKLAKKTFHGRGLIFACYQSSITSGFQFLQSSWVNNTTFPPFETTPEVPGVDPILGQGTDRKLTGTDPNNPAAELNLDDEWVIPRGGEYFFSPSIQGLTNTIAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACTCAGCAACCCCTGCCTCCCGTCACTCTCCCCCCTCCTACTCCTCCCAACCCAGCTCCTACACCTGTTTCCCTTAAACTCGAGAATATCCAGGGTGACATCTTGTGGGTGTAT
CGTCATTTTGCCATTAATTATCCAGTGTTGATGAATTCGTAATCGTAGGAGCGGCCTTCCCAAGAAGACAGAGACTTTGTATTTCTTCCAAATCACAGATGCTGTCAAGTTCCGCAAGGA
CCTCAAGAAATTCATACCCCTGGTCAAGAGCGTCGCCCAAGTGCTTAAAGACAGAGAGGAGATAGAGAAGCATAAACGTGACCATCATGCCAGTGTACTTCATGGCTTTAGACCTATCCT
CATCCCATTGGTCGGCGTCAACATTTCTTTCTCCCACTTCGGTTTCAAGAAG
GTAAATAGGTTTCATCTTGATACAGATCCGTCATATGTACTCACTCGAGGTCGTGCAGCTCGGAATCG
ATGACACCAAGTTAATTGACACTGCCTTCCTCGACGGGCAGCGTTTTGACGCTGGCGCCAACCTCGGGGACAAAGGTAGTGGCTCTGGACAAGACTTCGTCCCAGATTGGGAAGAACCTT
TCAAGAAGGAGATCCATGGTGTCATTATCCTCGCTGGTGATAGCCACCCCAGCGTCGACAAGAAACTTCAAGAGATCAAGCGCATCTTCGACGTTGGCGGTCGTACATCGTCCATTTCAG
AGATCACCTCCGTTCAGGGCGACGCTCGCCCAGGAGACCAATCAGCCCATGAGCA
GTAAGTGGTCAACATTTCTTTTGAGTGTCCAACCACCTTCTGATATCCCAAATCGCGGAACAGCT
TTGGATACCTCGATGGCGTGTCTAACCCTGCCATCATCGGATTCGACACCAATCCTCCACCAGGACCTGCTCCAGTTCGTGCAGGTGCAATCATCCTCGGCCAGGACGGCGACGAAAGCA
AGACCGAGCGTGCGCCATGGATGGTTGACGGAAGCTTCCTCGTTTTCAGATACCTCTTCCAGAAAGTGCCAGAGTTCGACGACTTTGTGTTCAGGAATCGACTCAAGGGCCCAGGAATGT
CTGACAAGGAAGGTGCTGACCTCCTTGGAGCACGTCTCATCGGTCGCTGGAAGAGTG
GTGCGTGATTTCCGTATCCTTTGACTCGGGTTATAGACTTAATTTTCTTCGAAGGTGCTCCTG
TTGATCTTTCTCCATTCCAGGATGACCCAGAACTCGGAGCTGATCCCCAAAG
GTAATAAATTAGTCAAATCTTTGAAAATACCTTAGCTGACTTTACCTCGTTGTAGGAATAACAACTTC
CACTTCTCGGCTGAGCTTAACTTCCAGAAACTTTGCCCATTCGCAGCGCACATCCGCAAGACTCTTCCCCGTGCCGATCTCGAGAGTCGTAGGATCTCCATTGAGAGGAATCGTATCATG
CGTCGAGGAATTCAGTTTGGACCTGAAGTCACCAGGGCCGAGAAACTGGCAAAGAAGACATTCCATGGTCGTGGATTGATCTTCGCCTGCTACCAGAGCAGCATCACCAGTGGCTTCCAA
TTCCTTCAGAGCA
GTGAGCAGTAATTTGTCAAAATGGTGTGATAGTCCTCTGACGCGGCTTGCTCCTCCAGGCTGGGTCAACAATACCACGTTCCCACCTTTTGAAACCACACCAGAAGT
TCCTGG
GTAGGCAGTTATCTTTCCTAGTTTGCCGAAACTGCTGAACGTAGGGTAATACAGAGTCGACCCGATTCTCGGTCAAGGTACAGACCGTAAATTGACAGGCACTGACCCCAACAA
CCCTGCTGCTGAGCTTAATCTTGATGACGAATGGGTAATCCCTCGTGGCGGAGAATACTTCTTCAGCCCGTCTATCCAGGGGTTGACCAACACAATCGCCGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACTCAGCAACCCCTGCCTCCCGTCACTCTCCCCCCTCCTACTCCTCCCAACCCAGCTCCTACACCTGTTTCCCTTAAACTCGAGAATATCCAGGGTGACATCTTGAGCGGCCTT
CCCAAGAAGACAGAGACTTTGTATTTCTTCCAAATCACAGATGCTGTCAAGTTCCGCAAGGACCTCAAGAAATTCATACCCCTGGTCAAGAGCGTCGCCCAAGTGCTTAAAGACAGAGAG
GAGATAGAGAAGCATAAACGTGACCATCATGCCAGTGTACTTCATGGCTTTAGACCTATCCTCATCCCATTGGTCGGCGTCAACATTTCTTTCTCCCACTTCGGTTTCAAGAAG
CTCGGA
ATCGATGACACCAAGTTAATTGACACTGCCTTCCTCGACGGGCAGCGTTTTGACGCTGGCGCCAACCTCGGGGACAAAGGTAGTGGCTCTGGACAAGACTTCGTCCCAGATTGGGAAGAA
CCTTTCAAGAAGGAGATCCATGGTGTCATTATCCTCGCTGGTGATAGCCACCCCAGCGTCGACAAGAAACTTCAAGAGATCAAGCGCATCTTCGACGTTGGCGGTCGTACATCGTCCATT
TCAGAGATCACCTCCGTTCAGGGCGACGCTCGCCCAGGAGACCAATCAGCCCATGAGCA
CTTTGGATACCTCGATGGCGTGTCTAACCCTGCCATCATCGGATTCGACACCAATCCTCCA
CCAGGACCTGCTCCAGTTCGTGCAGGTGCAATCATCCTCGGCCAGGACGGCGACGAAAGCAAGACCGAGCGTGCGCCATGGATGGTTGACGGAAGCTTCCTCGTTTTCAGATACCTCTTC
CAGAAAGTGCCAGAGTTCGACGACTTTGTGTTCAGGAATCGACTCAAGGGCCCAGGAATGTCTGACAAGGAAGGTGCTGACCTCCTTGGAGCACGTCTCATCGGTCGCTGGAAGAGTG
GT
GCTCCTGTTGATCTTTCTCCATTCCAGGATGACCCAGAACTCGGAGCTGATCCCCAAAG
GAATAACAACTTCCACTTCTCGGCTGAGCTTAACTTCCAGAAACTTTGCCCATTCGCAGCG
CACATCCGCAAGACTCTTCCCCGTGCCGATCTCGAGAGTCGTAGGATCTCCATTGAGAGGAATCGTATCATGCGTCGAGGAATTCAGTTTGGACCTGAAGTCACCAGGGCCGAGAAACTG
GCAAAGAAGACATTCCATGGTCGTGGATTGATCTTCGCCTGCTACCAGAGCAGCATCACCAGTGGCTTCCAATTCCTTCAGAGCA
GCTGGGTCAACAATACCACGTTCCCACCTTTTGAA
ACCACACCAGAAGTTCCTGG
AGTCGACCCGATTCTCGGTCAAGGTACAGACCGTAAATTGACAGGCACTGACCCCAACAACCCTGCTGCTGAGCTTAATCTTGATGACGAATGGGTAATC
CCTCGTGGCGGAGAATACTTCTTCAGCCCGTCTATCCAGGGGTTGACCAACACAATCGCCGCATAA

Retrieve as FASTA