Entry information : GmarDyPrx05
Entry ID 10707
Creation 2012-03-06 (Christophe Dunand)
Last sequence changes 2016-01-08 (Bruno Savelli)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarDyPrx05
Name GmarDyPrx05
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarDyPrx05
start..stop
S start..stop
CcinDyPrx03 607 0 1..525 1..544
GluxDyPrx02 397 4e-133 11..529 18..570
PplDyPrx01 398 2e-131 5..532 10..549
SbreDyPrx01 398 2e-129 2..528 7..582
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 238562..238714 153 N° 2 238784..239129 346 N° 3 239193..239340 148 N° 4 239403..239694 292
N° 5 239747..239959 213 N° 6 240014..240200 187 N° 7 240253..240515 263  
join(238562..238714,238784..239129,239193..239340,239403..239694,239747..239959, 240014..240200,240253..240515)


exon

Literature and cross-references GmarDyPrx05
DNA ref. JGI genome:   scaffold_7 (238562..240515)
Cluster/Prediction ref. JGI gene:   208622
Protein sequence: GmarDyPrx05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   534
PWM (Da):   %s   58835.66  
PI (pH):   %s   6.11
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLPKYKFLKRRAIVPHPTLLAGKPIKKDEDGNDLPNLDNVQGDIYFMFPKRWECFMFFNIIDGKLSQFRKDLDTYTPNITSSTQTAKDLDNINTNGGSNLDIVSSEIAFSKKGLTTMGVTDFLGDPHFDQGSLYNEKDKLGDKAQYDDVFNGNGKSHGVILITAGAQATCSTKTSDFQTIFKSSINVITTYEGRVRSGDGEHFGWRDGISQPALKDIGTSKPGQRVVKPGVVIMGYPGDSVYDDADAVARPDFTKDGSFMVFRKLEQNVLFLEDYVNKNWRSIPAKPASDVSLTDQQRKKLFAARMVGRFKTGVPLALAPYIEDTTLLDPDTINNFDYTEPDGRCPFAAHVRTTAPRNLLPIVSKEYLDSSVLVRAGIPYGDEISQKERDDWKNLSEDRKENAICPRGLLFACYQSSIDNGFYRQTTGFANNDFFPITGLVPQKIGQDPIIGGPKTVSGTTGTTDLSSEGEVTLRLVTSQGDKYEVAGVAKKVVDSATSYEQKFFVTSRGGEYYFVPSISTVKSWGAAAQPK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTTCCAAAATACAAATTTCTGAAGAGACGGGCCATTGTCCCTCATCCTACTTTGCTCGCCGGAAAGCCTATCAAGAAGGACGAGGATGGCAACGACCTGCCTAATCTCGACAAT
GTTCAGGGTGATATTTACTTTATGTTTCCGAAG
GTGAGATCAGAGACGTCCTTGCTATCCTTTTACGAATAGCTGAACTCGATTGCTGTACGCACGTCGCAGAGATGGGAATGCTTCATG
TTCTTCAACATTATCGACGGCAAACTCTCTCAGTTCAGGAAGGACCTCGACACCTATACTCCGAATATTACCAGTTCTACCCAGACAGCAAAAGACCTGGATAACATCAATACGAACGGA
GGGTCAAACCTCGATATTGTTTCCTCCGAGATCGCGTTCTCCAAGAAAGGGCTTACGACGATGGGCGTCACCGACTTTCTGGGGGATCCTCATTTTGATCAAGGCTCTTTGTACAACGAA
AAAGATAAGCTCGGGGACAAGGCCCAATACGATGATGTTTTCAACGGTAACGGTAAAAGTCATGGGGTTATCCTGATCACTGCTGGGG
GTAAGTTTGGCTTCACGGCCATGTATATGTGC
GCGCCACCTGTTCAATGCCATTTTTTTGCAGCGCAGGCCACATGCAGCACAAAGACAAGTGATTTCCAGACGATCTTCAAAAGTTCCATAAACGTCATAACCACCTATGAAGGCCGCGTC
CGTTCAGGTGATGGCGAGCACTTCGGATGGAGAGATGGTATTTCCCAACCCGCTCTCAA
GTATGTCCCCATAATATCTGTGATTTCGATCCGCTGTTGCTCGATTAGTAACCTGCAAACA
GGGATATTGGAACTTCAAAGCCGGGTCAGCGCGTCGTAAAGCCGGGCGTCGTTATAATGGGATACCCAGGAGACTCCGTCTACGATGATGCGGATGCGGTGGCACGTCCTGACTTCACAA
AGGACGGGTCTTTTATGGTATTCCGCAAGCTCGAACAGAACGTGCTGTTCCTCGAAGATTATGTGAACAAGAACTGGAGATCTATCCCAGCCAAGCCTGCTTCTGATGTTTCCCTCACTG
ACCAACAGAGGAAGAAGTTGTTCGCAGCAAGGATGGTCGGTCGCTTTAAGACG
GTGAGCTACACTGTACATGTATTGATAAGTGAATGCTGAATATAAATAAAAGGGTGTGCCGCTTGCC
CTTGCTCCGTACATCGAGGATACTACCCTCCTGGATCCTGATACGATCAACAATTTCGATTACACAGAACCAGACGGTCGTTGCCCCTTCGCTGCTCACGTTCGTACCACGGCTCCCCGG
AACTTGCTGCCAATCGTAAGCAAAGAATACCTGGATTCATCCGTCCTTGTTCGCGCAGGCATCCCCTATGGTGATGAG
GTTCGTGAACACAAATTTCCGGTAGACGAGTTAAGATTACCT
TTTGTTTAACAGATTTCGCAGAAAGAGCGGGATGACTGGAAAAACCTTAGCGAAGACCGGAAGGAGAATGCCATCTGCCCTCGCGGGCTGCTCTTCGCTTGCTACCAATCGTCCATCGAC
AATGGGTTTTACCGTCAAACCACTGGCTTTGCTAATAATGATTTCTTTCCTATCACTGGTCTCGTACCTCAGAAAATTG
GTTTGTGGAGCCTTTCCAGACGCGATGAACTTGACGCTGAA
TCTTTAAACAGGACAAGATCCTATCATTGGAGGACCAAAGACGGTCTCGGGAACCACGGGCACGACTGATTTGTCCTCAGAAGGCGAGGTTACACTCCGTCTTGTCACTAGTCAAGGCGA
TAAGTATGAAGTAGCCGGGGTTGCGAAGAAAGTCGTTGATTCAGCGACGTCGTATGAGCAGAAATTCTTCGTAACCTCACGCGGAGGGGAATATTATTTCGTGCCGAGCATCAGCACAGT
AAAAAGTTGGGGTGCAGCCGCACAACCGAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTTCCAAAATACAAATTTCTGAAGAGACGGGCCATTGTCCCTCATCCTACTTTGCTCGCCGGAAAGCCTATCAAGAAGGACGAGGATGGCAACGACCTGCCTAATCTCGACAAT
GTTCAGGGTGATATTTACTTTATGTTTCCGAAG
AGATGGGAATGCTTCATGTTCTTCAACATTATCGACGGCAAACTCTCTCAGTTCAGGAAGGACCTCGACACCTATACTCCGAATATT
ACCAGTTCTACCCAGACAGCAAAAGACCTGGATAACATCAATACGAACGGAGGGTCAAACCTCGATATTGTTTCCTCCGAGATCGCGTTCTCCAAGAAAGGGCTTACGACGATGGGCGTC
ACCGACTTTCTGGGGGATCCTCATTTTGATCAAGGCTCTTTGTACAACGAAAAAGATAAGCTCGGGGACAAGGCCCAATACGATGATGTTTTCAACGGTAACGGTAAAAGTCATGGGGTT
ATCCTGATCACTGCTGGGG
CGCAGGCCACATGCAGCACAAAGACAAGTGATTTCCAGACGATCTTCAAAAGTTCCATAAACGTCATAACCACCTATGAAGGCCGCGTCCGTTCAGGTGAT
GGCGAGCACTTCGGATGGAGAGATGGTATTTCCCAACCCGCTCTCAA
GGATATTGGAACTTCAAAGCCGGGTCAGCGCGTCGTAAAGCCGGGCGTCGTTATAATGGGATACCCAGGAGAC
TCCGTCTACGATGATGCGGATGCGGTGGCACGTCCTGACTTCACAAAGGACGGGTCTTTTATGGTATTCCGCAAGCTCGAACAGAACGTGCTGTTCCTCGAAGATTATGTGAACAAGAAC
TGGAGATCTATCCCAGCCAAGCCTGCTTCTGATGTTTCCCTCACTGACCAACAGAGGAAGAAGTTGTTCGCAGCAAGGATGGTCGGTCGCTTTAAGACG
GGTGTGCCGCTTGCCCTTGCT
CCGTACATCGAGGATACTACCCTCCTGGATCCTGATACGATCAACAATTTCGATTACACAGAACCAGACGGTCGTTGCCCCTTCGCTGCTCACGTTCGTACCACGGCTCCCCGGAACTTG
CTGCCAATCGTAAGCAAAGAATACCTGGATTCATCCGTCCTTGTTCGCGCAGGCATCCCCTATGGTGATGAG
ATTTCGCAGAAAGAGCGGGATGACTGGAAAAACCTTAGCGAAGACCGG
AAGGAGAATGCCATCTGCCCTCGCGGGCTGCTCTTCGCTTGCTACCAATCGTCCATCGACAATGGGTTTTACCGTCAAACCACTGGCTTTGCTAATAATGATTTCTTTCCTATCACTGGT
CTCGTACCTCAGAAAATTG
GACAAGATCCTATCATTGGAGGACCAAAGACGGTCTCGGGAACCACGGGCACGACTGATTTGTCCTCAGAAGGCGAGGTTACACTCCGTCTTGTCACTAGT
CAAGGCGATAAGTATGAAGTAGCCGGGGTTGCGAAGAAAGTCGTTGATTCAGCGACGTCGTATGAGCAGAAATTCTTCGTAACCTCACGCGGAGGGGAATATTATTTCGTGCCGAGCATC
AGCACAGTAAAAAGTTGGGGTGCAGCCGCACAACCGAAGTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2

ATGTCTCTTC CAAAATACA 

Retrieve as FASTA