Entry information : OsPrx61 (Os04g59190)
Entry ID 1071
Creation 2006-07-25 (Filippo Passardi)
Last sequence changes 2010-08-03 (Marie Brette (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-12-21 (Christophe Dunand)
Peroxidase information: OsPrx61 (Os04g59190)
Name (synonym) OsPrx61 (Os04g59190)
Class Class III peroxidase    [Orthogroup: Prx068]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Callus
Pannicles
Roots
Seeds
Shoots
Inducer Abscission
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx61
start..stop
S start..stop
OsPrx64 449 9e-160 12..340 8..338
OsPrx63 440 3e-156 12..335 7..329
OsPrx62 431 2e-152 7..340 6..350
HvPrx03 397 3e-139 1..340 1..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35243391..35243645 255 N° 2 35242468..35243235 768  
complement(join(35242468..35243235,35243391..35243645))


exon

Literature and cross-references OsPrx61 (Os04g59190)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1N2
DNA ref. GenBank:   NC_008397.1 (35243645..35242471)
Cluster/Prediction ref. UniGene:   Os.7938
Protein sequence: OsPrx61 (Os04g59190)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340 (305)
PWM (Da):   %s   35134.17 (31977.4) Transmb domain:   %s   i12-34o
PI (pH):   %s   8.21 (7.98) Peptide Signal:   %s   cut: 36 range:36-340
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAATAGRTAGALAVLQLASIVAAAVLLSSPPAAAAEPSVDFIDVVACSQSQVDSIVRSAVQAALQREIALAAGLIRIFFHDCFPQGCDASVYLSGANSEQGMPPNANSLQPRALQLVEDIRAKVHAACGPTVSCTDISALATRAAVVLSGGPTYPVPLGQLDSLAPAPLRLVNQLPGPGTSSVQALIDLFGSRGMGDAADLVALSGGHTVGKSKCAFVRPVDDAFSRKMAANCSANPNTKQDLDVVTPITFDNGYYIALTRKQGVFTSDMALILDPQTAAIVRRFAQDKAAFFTQFVTSIVKLSKVPRPGGNKGEIRRNCFKTNSGARLVDVVEGFAASA*

Retrieve as FASTA  
Remarks chromosome 4. 2 cDNA and 158 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCAACAGCGGGCAGGACCGCGGGCGCATTGGCCGTCCTGCAGCTCGCCTCCATCGTCGCCGCTGCCGTCCTCCTCTCCTCCCCACCTGCGGCTGCTGCTGAGCCGTCTGTGGAC
TTCATTGACGTGGTGGCGTGCTCGCAGTCGCAGGTGGACTCCATCGTGCGCTCAGCCGTGCAGGCGGCGCTCCAGCGTGAGATCGCCCTCGCCGCCGGCCTCATCCGTATCTTCTTCCAC
GACTGCTTCCCGCAG
GCACTTGCTACTATATATACTCTACCTTTTTATGAACTAAACCAACCAACCATCTAATTGAATGAATGTTTAATTCAAGCAAAAACGATCGTGTACGTACTATAC
TAATGGCAAAAGAAGAAAAAAAAGATTAACTGATGATGGAATTAATGCAGGGCTGTGACGCGTCGGTTTACTTGAGTGGCGCCAACTCGGAGCAGGGGATGCCGCCCAACGCCAACTCGC
TGCAGCCGCGGGCGCTGCAGCTGGTGGAGGACATCCGCGCCAAGGTGCACGCCGCATGCGGGCCCACCGTCTCCTGCACCGACATCTCCGCGCTGGCCACCCGCGCGGCCGTCGTCCTCT
CCGGCGGGCCCACCTACCCCGTTCCCCTCGGCCAGCTCGACAGCCTCGCCCCGGCCCCGCTGCGCCTCGTCAACCAGCTCCCGGGCCCGGGCACCTCCAGCGTCCAGGCTCTCATCGACC
TGTTCGGGAGCAGGGGCATGGGAGACGCCGCCGACCTGGTGGCGCTCTCCGGCGGCCACACCGTGGGGAAGTCAAAGTGCGCCTTCGTGAGGCCCGTGGACGACGCCTTCTCCCGGAAGA
TGGCCGCCAACTGCAGCGCCAACCCCAACACGAAGCAGGACCTGGACGTCGTCACCCCCATCACCTTCGACAACGGCTACTACATAGCGCTCACCAGGAAGCAGGGGGTGTTCACCTCCG
ACATGGCGCTCATCCTGGACCCCCAAACTGCGGCCATCGTCAGGCGGTTCGCGCAGGACAAGGCCGCCTTCTTCACGCAGTTCGTTACGTCCATCGTCAAGCTGAGCAAGGTGCCGAGGC
CCGGCGGGAACAAAGGCGAGATCCGCCGCAACTGCTTCAAGACCAACAGCGGAGCACGCCTCGTGGACGTCGTGGAGGGCTTCGCTGCCTCTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCAACAGCGGGCAGGACCGCGGGCGCATTGGCCGTCCTGCAGCTCGCCTCCATCGTCGCCGCTGCCGTCCTCCTCTCCTCCCCACCTGCGGCTGCTGCTGAGCCGTCTGTGGAC
TTCATTGACGTGGTGGCGTGCTCGCAGTCGCAGGTGGACTCCATCGTGCGCTCAGCCGTGCAGGCGGCGCTCCAGCGTGAGATCGCCCTCGCCGCCGGCCTCATCCGTATCTTCTTCCAC
GACTGCTTCCCGCAG
GGCTGTGACGCGTCGGTTTACTTGAGTGGCGCCAACTCGGAGCAGGGGATGCCGCCCAACGCCAACTCGCTGCAGCCGCGGGCGCTGCAGCTGGTGGAGGACATC
CGCGCCAAGGTGCACGCCGCATGCGGGCCCACCGTCTCCTGCACCGACATCTCCGCGCTGGCCACCCGCGCGGCCGTCGTCCTCTCCGGCGGGCCCACCTACCCCGTTCCCCTCGGCCAG
CTCGACAGCCTCGCCCCGGCCCCGCTGCGCCTCGTCAACCAGCTCCCGGGCCCGGGCACCTCCAGCGTCCAGGCTCTCATCGACCTGTTCGGGAGCAGGGGCATGGGAGACGCCGCCGAC
CTGGTGGCGCTCTCCGGCGGCCACACCGTGGGGAAGTCAAAGTGCGCCTTCGTGAGGCCCGTGGACGACGCCTTCTCCCGGAAGATGGCCGCCAACTGCAGCGCCAACCCCAACACGAAG
CAGGACCTGGACGTCGTCACCCCCATCACCTTCGACAACGGCTACTACATAGCGCTCACCAGGAAGCAGGGGGTGTTCACCTCCGACATGGCGCTCATCCTGGACCCCCAAACTGCGGCC
ATCGTCAGGCGGTTCGCGCAGGACAAGGCCGCCTTCTTCACGCAGTTCGTTACGTCCATCGTCAAGCTGAGCAAGGTGCCGAGGCCCGGCGGGAACAAAGGCGAGATCCGCCGCAACTGC
TTCAAGACCAACAGCGGAGCACGCCTCGTGGACGTCGTGGAGGGCTTCGCTGCCTCTGCTTAA

Retrieve as FASTA