Entry information : PgrCcP01
Entry ID 10710
Creation 2012-03-07 (Christophe Dunand)
Last sequence changes 2012-03-07 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: PgrCcP01
Name PgrCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Fungi/Metazoa; Fungi; Basidiomycota; Basidiomycota
Organism Puccinia graminis f. sp. tritici    [TaxId: 56615 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PgrCcP01
start..stop
S start..stop
PUtriCcP01 616 0 1..314 1..314
CqueCcP01 538 0 1..314 1..314
MlpCcP01 504 0 1..314 1..314
MvioCcP01 422 4e-150 1..290 1..283
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1455155..1455305 151 N° 2 1455379..1455540 162 N° 3 1455606..1455808 203 N° 4 1455913..1455960 48
N° 5 1456056..1456178 123 N° 6 1456267..1456524 258  
join(1455155..1455305,1455379..1455540,1455606..1455808,1455913..1455960,1456056 ..1456178,1456267..1456524)


exon

Literature and cross-references PgrCcP01
DNA ref. JGI genome:   supercontig_2_8 (1455155..1456524)
Cluster/Prediction ref. JGI gene:   24715
Protein sequence: PgrCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   314
PWM (Da):   %s   35029.2  
PI (pH):   %s   6.35
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSREFDYDAVCDSIRRILNQPGYDNYDEDVKHTAGPVLVRLAWHAAGTYDKETDTGGSDGAGMRYEAEGGDPANAGLQHARVFLEPVKKEHPWITYADLWTLAGVVAVKEMGGPQVHWKPGRTDFMDDSKCPPRGRLPDASLAHDHLRQVFYRMGFNDREIVALSGAHNLKCHTDRSGYEGPWVNNPTRFSNQYFKLLKKLEWKPKKWGGPLQFVNSDFGEELMMLPTDRALVSDPSFSQWVDKYAEDRDLFFSDFADAFSKLLELGVKRDQHSYKPAGKKSDQPGAPGSSAQDAEAEPVRRGNIATGKTKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCTCTAGAGAATTCGACTACGACGCTGTTTGCGACTCTATCCGCCGTATTCTTAACCAACCTGGCTACGATAATTACGACGAGGATGTCAAACATACCGCTGGCCCAGTGCTCGTT
CGATTAGCCTGGCATGCTGCCGGGACCTATG
GTAAGTTGATTCAAGACCAATTCTCAATTCTTAAGCAGCAGACCTGACTGATACTTTTTTCGTAATTTACCAGATAAGGAGACTGATAC
GGGTGGCTCAGATGGTGCCGGAATGAGATACGAGGCCGAAGGTGGGGACCCCGCTAACGCAGGACTTCAACATGCCCGAGTATTTCTAGAACCTGTCAAGAAGGAACACCCTTGGATTAC
CTACGCTGATCTGTGGACACTAGCCG
GTATGTCCAACTTACTCTCACCTGACTCAATCTCACATCCAACTCATCCATCGTTGAATCCATAGGTGTGGTAGCGGTAAAGGAGATGGGCGGG
CCCCAAGTACACTGGAAGCCTGGCCGAACGGACTTCATGGATGACTCCAAGTGCCCACCTAGAGGTCGACTTCCTGATGCCTCCTTGGCACATGACCATCTTCGCCAAGTCTTTTATCGT
ATGGGGTTCAATGATCGCGAGATTGTCGCCTTGTCCGGAGCCCATAACTTGGGC
GTAAGTCTTGGATACCTAAATATTTCTTCGTTACAATCAAACGATTTCCATCACACTCAGGCTCAT
CTTTCGATTTCGATTTTTTTGTTTTTGCTTTTCATCAGAAATGCCACACGGACCGATCAGGCTACGAAGGCCCTTGGGTGAACAATGTAAGTCGAAACTCTGAACGTCGGGAATCCGCGG
AAACTCATCCTGCCTGTTATTTTTTGTGGGTGTCTCCAATAATCCTCTCGCTGCTCACTAGCCCACAAGATTCAGCAACCAATACTTCAAGCTCCTCAAGAAATTAGAGTGGAAGCCCAA
GAAGTGGGGTGGACCACTGCAATTTGTGAATTCGGACTTTGGCGAAGAGTTGATGATGCTACCT
GTAGGTTCCATTGATGCATGATGTTTCTTGACTGTCGATATCGTGATACTGATCAC
ATTTCCTCAAAAAAATTCAATGATACCTCCAGACCGATCGCGCTTTGGTTTCCGATCCGTCGTTCAGTCAGTGGGTCGACAAATACGCCGAGGATCGAGACCTCTTTTTCTCCGACTTTG
CCGATGCCTTTTCCAAGCTGCTTGAGCTTGGTGTCAAGAGAGATCAGCACTCTTACAAACCAGCCGGCAAGAAATCCGATCAGCCTGGGGCCCCCGGTTCCAGTGCTCAGGATGCTGAAG
CCGAGCCCGTCAGACGGGGTAATATCGCCACGGGCAAGACCAAGTTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCTCTAGAGAATTCGACTACGACGCTGTTTGCGACTCTATCCGCCGTATTCTTAACCAACCTGGCTACGATAATTACGACGAGGATGTCAAACATACCGCTGGCCCAGTGCTCGTT
CGATTAGCCTGGCATGCTGCCGGGACCTATG
ATAAGGAGACTGATACGGGTGGCTCAGATGGTGCCGGAATGAGATACGAGGCCGAAGGTGGGGACCCCGCTAACGCAGGACTTCAACAT
GCCCGAGTATTTCTAGAACCTGTCAAGAAGGAACACCCTTGGATTACCTACGCTGATCTGTGGACACTAGCCG
GTGTGGTAGCGGTAAAGGAGATGGGCGGGCCCCAAGTACACTGGAAG
CCTGGCCGAACGGACTTCATGGATGACTCCAAGTGCCCACCTAGAGGTCGACTTCCTGATGCCTCCTTGGCACATGACCATCTTCGCCAAGTCTTTTATCGTATGGGGTTCAATGATCGC
GAGATTGTCGCCTTGTCCGGAGCCCATAACTTGGGC
AAATGCCACACGGACCGATCAGGCTACGAAGGCCCTTGGGTGAACAATCCCACAAGATTCAGCAACCAATACTTCAAGCTCCTC
AAGAAATTAGAGTGGAAGCCCAAGAAGTGGGGTGGACCACTGCAATTTGTGAATTCGGACTTTGGCGAAGAGTTGATGATGCTACCT
ACCGATCGCGCTTTGGTTTCCGATCCGTCGTTC
AGTCAGTGGGTCGACAAATACGCCGAGGATCGAGACCTCTTTTTCTCCGACTTTGCCGATGCCTTTTCCAAGCTGCTTGAGCTTGGTGTCAAGAGAGATCAGCACTCTTACAAACCAGCC
GGCAAGAAATCCGATCAGCCTGGGGCCCCCGGTTCCAGTGCTCAGGATGCTGAAGCCGAGCCCGTCAGACGGGGTAATATCGCCACGGGCAAGACCAAGTTGTGA

Retrieve as FASTA