Entry information : PstrCcP (CCP1)
Entry ID 10711
Creation 2012-03-07 (Christophe Dunand)
Last sequence changes 2012-03-07 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: PstrCcP (CCP1)
Name (synonym) PstrCcP (CCP1)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Punctularia
Organism Punctularia strigosozonata    [TaxId: 202698 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PstrCcP
start..stop
S start..stop
SnivCcP01 595 0 3..371 1..365
AthiCcP01 579 0 1..371 1..369
MfiaCcP01 579 0 1..371 1..377
TcamCcP 574 0 1..371 1..372
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1169398..1169694 297 N° 2 1169749..1169797 49 N° 3 1169850..1169931 82 N° 4 1169982..1170569 588
N° 5 1170657..1170759 103  
join(1169398..1169694,1169749..1169797,1169850..1169931,1169982..1170569,1170657 ..1170759)


exon

Literature and cross-references PstrCcP (CCP1)
DNA ref. JGI genome:   scaffold_3 (1169398..1170759)
Cluster/Prediction ref. JGI gene:   83156
Protein sequence: PstrCcP (CCP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   373
PWM (Da):   %s   40820.47 Transmb domain:   %s   i41-63o
PI (pH):   %s   8.71
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFQALRAAARTARIAPRAFPKASARAAVRRYTTENAGKKSSNVAIYAGIAAVAAAGAGYWVLTSDSDAAKEAGTLAKSGAQVAKAAANYTPSKEDYQKVYNRIAEIIDDAGEYDDGSYGPVLVRLAWHASGTFDKETGTGGSNYATMRFEPEALHGANNGLHVARGLMEKVKEEYPWISYGDLWTLAGVAAIQEMGGPKIPWRPGRIDGFAKDATPDGRLPDATQGADHLRAIFYRMGFNDQEIVALSGAHALGRCHTDRSGFDGPWTFSPTTLTNDYFKLLFDEKWVWKKWSGPKQLVDKKTGSLMMLPTDYVLTQDKSFKKYAKAYAQDQDLFFKDFADVVSRLFELGVPQAQFVSSEPWLMKKTDEQS

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCCAAGCCCTCCGCGCTGCTGCACGCACCGCCCGCATTGCGCCTCGCGCTTTCCCCAAAGCATCCGCTCGCGCCGCCGTGCGCCGCTACACGACCGAGAACGCCGGAAAGAAG
AGCTCGAACGTAGCTATCTACGCCGGTATCGCTGCCGTCGCGGCTGCTGGCGCTGGCTACTGGGTTTTGACCAGCGACAGTGACGCGGCGAAGGAGGCTGGCACCCTCGCCAAGTCCGGC
GCCCAGGTCGCGAAGGCGGCAGCGAACTACACTCCGTCCAAGGAGGACTACCAGAAG
GTGTGCCGTGGTTCTCTTGTCCCGCTCTGAGCCCTCTCCTCATTATTTCGCCAGGTGTACAAC
CGCATTGCGGAGATCATCGACGACGCTGGGGAGTACGATG
GTAATAAAGTAATAGTATTGTTCAGGTAGCAATCGTTTACGCGATGACTTAGATGGCTCTTACGGCCCTGTCCTTGTCCG
CCTCGCATGGCACGCTTCTGGTACCTTTGACAAGGAGACAGGAACCGGTGGAAG
GTTAGCTAATCCGTTTCATCACTTAACAAGTTTCTCATGGTTCGCTCCAGCAACTACGCTACTATG
CGTTTCGAGCCCGAGGCCTTGCACGGCGCCAACAACGGCCTGCACGTCGCCCGTGGCCTGATGGAGAAGGTCAAGGAGGAGTACCCCTGGATCTCCTACGGTGATCTCTGGACGCTCGCC
GGTGTCGCCGCCATCCAGGAGATGGGCGGTCCCAAGATCCCCTGGCGCCCGGGCCGCATCGACGGCTTTGCGAAGGACGCGACTCCCGACGGTCGCCTGCCCGACGCGACGCAGGGCGCG
GACCATCTCCGCGCGATCTTCTACCGCATGGGCTTCAACGACCAGGAGATCGTCGCTCTCTCCGGCGCGCACGCGCTCGGCCGGTGCCACACCGACCGCTCCGGGTTCGACGGCCCGTGG
ACGTTCAGCCCGACGACGCTCACGAACGACTACTTCAAGCTGCTCTTCGACGAGAAGTGGGTGTGGAAGAAGTGGAGCGGTCCGAAGCAGCTCGTGGACAAGAAGACGGGCAGCCTGATG
ATGCTTCCGACCGACTACGTGCTCACGCAGGACAAGAGCTTCAAGAAGTACGCCAAGGCGTACGCGCAGGACCAGGATCTGTTCTTCAAGGA
GTGCGTATCCGCCTTCTCTCACGCGTCT
CCCGCGACCGTCATCTGACCGCGTATTTTACCTTTTTACCTTTCGGTGCCCACGAACAGCTTCGCTGACGTCGTCTCCCGCTTGTTCGAGCTCGGCGTGCCGCAGGCGCAGTTCGTCTCT
TCCGAGCCGTGGCTGATGAAGAAGACCGACGAGCAGTCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCCAAGCCCTCCGCGCTGCTGCACGCACCGCCCGCATTGCGCCTCGCGCTTTCCCCAAAGCATCCGCTCGCGCCGCCGTGCGCCGCTACACGACCGAGAACGCCGGAAAGAAG
AGCTCGAACGTAGCTATCTACGCCGGTATCGCTGCCGTCGCGGCTGCTGGCGCTGGCTACTGGGTTTTGACCAGCGACAGTGACGCGGCGAAGGAGGCTGGCACCCTCGCCAAGTCCGGC
GCCCAGGTCGCGAAGGCGGCAGCGAACTACACTCCGTCCAAGGAGGACTACCAGAAG
GTGTACAACCGCATTGCGGAGATCATCGACGACGCTGGGGAGTACGATGATGGCTCTTACGGC
CCTGTCCTTGTCCGCCTCGCATGGCACGCTTCTGGTACCTTTGACAAGGAGACAGGAACCGGTGGAAG
CAACTACGCTACTATGCGTTTCGAGCCCGAGGCCTTGCACGGCGCCAACAAC
GGCCTGCACGTCGCCCGTGGCCTGATGGAGAAGGTCAAGGAGGAGTACCCCTGGATCTCCTACGGTGATCTCTGGACGCTCGCCGGTGTCGCCGCCATCCAGGAGATGGGCGGTCCCAAG
ATCCCCTGGCGCCCGGGCCGCATCGACGGCTTTGCGAAGGACGCGACTCCCGACGGTCGCCTGCCCGACGCGACGCAGGGCGCGGACCATCTCCGCGCGATCTTCTACCGCATGGGCTTC
AACGACCAGGAGATCGTCGCTCTCTCCGGCGCGCACGCGCTCGGCCGGTGCCACACCGACCGCTCCGGGTTCGACGGCCCGTGGACGTTCAGCCCGACGACGCTCACGAACGACTACTTC
AAGCTGCTCTTCGACGAGAAGTGGGTGTGGAAGAAGTGGAGCGGTCCGAAGCAGCTCGTGGACAAGAAGACGGGCAGCCTGATGATGCTTCCGACCGACTACGTGCTCACGCAGGACAAG
AGCTTCAAGAAGTACGCCAAGGCGTACGCGCAGGACCAGGATCTGTTCTTCAAGGA
CTTCGCTGACGTCGTCTCCCGCTTGTTCGAGCTCGGCGTGCCGCAGGCGCAGTTCGTCTCTTCC
GAGCCGTGGCTGATGAAGAAGACCGACGAGCAGTCCTGA

Retrieve as FASTA