Entry information : RgraCcP01
Entry ID 10714
Creation 2012-03-07 (Christophe Dunand)
Last sequence changes 2012-03-07 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: RgraCcP01
Name RgraCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Basidiomycota Rhodotorula
Organism Rhodotorula graminis    [TaxId: 29898 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RgraCcP01
start..stop
S start..stop
RmucCcP1_C2.5t1 529 0 5..304 4..302
SrosCcP02 484 4e-175 17..304 14..301
MvioCcP01 452 2e-162 12..293 2..281
UhorCcP01 437 7e-156 15..278 2..270
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 245443..245582 140 N° 2 245823..245924 102 N° 3 245999..246167 169 N° 4 246262..246465 204
N° 5 246555..246608 54 N° 6 246674..246708 35 N° 7 246787..246839 53 N° 8 246916..246956 41
N° 9 247025..247069 45 N° 10 247152..247220 69  
join(245443..245582,245823..245924,245999..246167,246262..246465,246555..246608, 246674..246708,246787..246839,246916..246956,247025..247069,247152..247220)


exon

Literature and cross-references RgraCcP01
DNA ref. JGI genome:   scaffold_11 (245443..247220)
Cluster/Prediction ref. JGI gene:   38461
Protein sequence: RgraCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   305
PWM (Da):   %s   34196.75  
PI (pH):   %s   5.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSAPKTQKDAASPSRKGDFDAVRNDIASILDQPDYDDGSIGPVLVRLAWHASGTYCAETKTGGSNGAGMRYEAEGGDPANAGLEHARRFLEPVKEKHPWITYADLWTLAGVVAIKEMGGPDCKWKPGRTDFVDDSCPPRGRLPDGAQAAEHLRFIFYRMGFNDQEIVALAGAHSLGRCHSDRSGWEGPWSVTPTKFSTQYYKMLTKFKWEEKKWEGPRQFRNEDLGEELMMLPTDMALIEDEKFIPWVKYAEDRDAFYKDFAVFSKLIELGVERTDDYESAPTFSKAEGDKKEQEAKSKI

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGTCGGCACCCAAGACCCAGAAGGACGCCGCCTCGCCCTCGCGCAAGGGCGACTTTGACGCTGTCCGCAACGACATTGCCAGCATCCTCGACCAGCCCGACTACGACGATGGCTCG
ATCGGCCCTGTCCTCGTCCG
GTGAGCCTCCCCTTCTCCCTCTCGGCGACTTGGTGCGTGGGCCGGAGCATGTGGCACTTGCTCGCCGCTGGACCCGGTGCAGCGCGAGACGAGCGGGTTC
TTCTCGAGCTAGAACTGCACCGGACAGGCGCACGGCCGCGTCCCTGCAGGAGGCGCACGCCGGGAATTCACGCTCAACCGGCTGTGGCGAGCCGGCAGAGAACGAGCGACGACGACTGAC
CATGCCCCTCCTGCGCGCAGCCTCGCATGGCACGCCTCGGGCACGTACTGCGCCGAGACCAAGACGGGCGGCAGCAACGGCGCCGGCATGCGGTACGAGGCAGAGGGAGGCGACCCGGCC
AA
GTGCGTCCTGGCCCCTCCTTCCTCCAGGCTCCTTGTCCAGCAGCCGACTGACGCCTCGCCCTTACCCCTCGCAGCGCCGGTCTCGAGCACGCGCGCCGGTTCCTCGAGCCCGTCAAGG
AGAAGCACCCGTGGATCACGTACGCCGACCTGTGGACCCTCGCCGGCGTCGTCGCCATCAAGGAGATGGGCGGGCCCGACTGCAAGTGGAAGCCCGGCCGCACCGACTTTGTCGACGATT
CCAAG
GTGCGTCGTCTTCTCCTCGTCTCGTCCTCCCATGTTAAGGGCGTCGTCCTGACCCAACCTGTCCCTCCCCCTCCTCCCTCCTTCGCGCCCGCAGTGCCCGCCGCGTGGCCGCCTG
CCCGACGGTGCCCAGGCCGCCGAGCACCTGCGCTTCATCTTCTACCGCATGGGCTTCAACGACCAGGAGATTGTCGCGCTCGCCGGCGCCCACTCGCTCGGCCGGTGCCACTCGGACCGC
TCGGGCTGGGAGGGCCCGTGGAGCGTGACGCCGACCAAGTTCAGCACGCAGTACTACAAGATG
GTGAGCCGCTCGCTTCTCTCCCGACCGTCTCGCGCACGGCAGCCGTCGAGAATCACC
TCGACTGACAATCTCGTCCTCGTGCCTCGCAGCTCACCAAGTTCAAGTGGGAGGAGAAGAAGTGGGAGGGCCCGCGCCAGTTCCGGGTGCGTCCTCTCTCGTTCTCTCATTGCACTCGCG
TCGTACTGACGAGGCCCCTGCGCGCCCGCAGAACGAGGACCTCGGCGAGGAGCTCATGATGTTGCCGTGCGTCCCCCCTCTCCCTCTTTCACTGGCTCTTCCACTCCCTATCGAGCCCGT
CCTGACTTCTGTCTCCCCTCACAGGACCGACATGGCGCTCATCGAGGACGAGAAGTTCATCCCCTGGGTCAAGAAGTGTACGTCGCCGTCGTCTCGAGCCCGTCGCGCCGCACAGACCGC
CGAGGCTCACGCTCCCTTTTACCCGCCCTGCAGACGCCGAGGACCGCGACGCGTTCTACAAGGACTTTGCCGATGTGCGTCCTCGCTTCTCTTCTCTCGTCCCTCGACGCGCACTGACCC
GCTCGTCCTCCTCGACTCACAGGTCTTCTCCAAGCTCATCGAGCTCGGCGTCGAGCGCACCGACGACGTGCGTCTCTCTTTCTCTCTCTCAGTGCCTCTGTCTCCTACGCGAGTCGACAC
TGACCTCGAGGCCGTCGCTGTGCCCGCAGTACGAGAGCGCGCCGACGTTCTCCAAGGCCGAGGGCGACAAGAAGGAGCAGGAGGCCAAGTCGAAGATC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGTCGGCACCCAAGACCCAGAAGGACGCCGCCTCGCCCTCGCGCAAGGGCGACTTTGACGCTGTCCGCAACGACATTGCCAGCATCCTCGACCAGCCCGACTACGACGATGGCTCG
ATCGGCCCTGTCCTCGTCCG
CCTCGCATGGCACGCCTCGGGCACGTACTGCGCCGAGACCAAGACGGGCGGCAGCAACGGCGCCGGCATGCGGTACGAGGCAGAGGGAGGCGACCCGGCC
AA
CGCCGGTCTCGAGCACGCGCGCCGGTTCCTCGAGCCCGTCAAGGAGAAGCACCCGTGGATCACGTACGCCGACCTGTGGACCCTCGCCGGCGTCGTCGCCATCAAGGAGATGGGCGGG
CCCGACTGCAAGTGGAAGCCCGGCCGCACCGACTTTGTCGACGATTCCAAG
TGCCCGCCGCGTGGCCGCCTGCCCGACGGTGCCCAGGCCGCCGAGCACCTGCGCTTCATCTTCTACCGC
ATGGGCTTCAACGACCAGGAGATTGTCGCGCTCGCCGGCGCCCACTCGCTCGGCCGGTGCCACTCGGACCGCTCGGGCTGGGAGGGCCCGTGGAGCGTGACGCCGACCAAGTTCAGCACG
CAGTACTACAAGATG
CTCACCAAGTTCAAGTGGGAGGAGAAGAAGTGGGAGGGCCCGCGCCAGTTCCGGAACGAGGACCTCGGCGAGGAGCTCATGATGTTGCCGACCGACATGGCGCTC
ATCGAGGACGAGAAGTTCATCCCCTGGGTCAAGAAGT
ACGCCGAGGACCGCGACGCGTTCTACAAGGACTTTGCCGATGTCTTCTCCAAGCTCATCGAGCTCGGCGTCGAGCGCACCGAC
GAC
TACGAGAGCGCGCCGACGTTCTCCAAGGCCGAGGGCGACAAGAAGGAGCAGGAGGCCAAGTCGAAGATC

Retrieve as FASTA