Entry information : AalcCcP01
Entry ID 10715
Creation 2012-03-08 (Christophe Dunand)
Last sequence changes 2012-03-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: AalcCcP01
Name AalcCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Acremonium
Organism Acremonium alcalophilum    [TaxId: 398408 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AalcCcP01
start..stop
S start..stop
CgraCcP01 582 0 1..359 1..358
ChigCcP 571 0 3..359 2..358
CgloCcP01_ST23 570 0 1..359 1..358
VdaCcP01 560 0 1..359 1..357
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2454717..2455215 499 N° 2 2455278..2455864 587  
join(2454717..2455215,2455278..2455864)


exon

Literature and cross-references AalcCcP01
DNA ref. JGI genome:   scaffold_3 (2454717..2455864)
Cluster/Prediction ref. JGI gene:   2101603
Protein sequence: AalcCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   362
PWM (Da):   %s   40303.12  
PI (pH):   %s   8.36
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAANVSRQFARSALRSSARGAFVAAPRQAFRSQGRRFYSSEPLKSGSSTWIWVSGLVAAGAGGAWYYTQQGGVSAGSAPKVITNPTKEDYQAVYDDIAARLIEHDDYEDGSYGPVLLRLAWHASGTYDKETGTGGSNGATMRFSPEADHGANAGLKNARDFLEPVKEKFPWITYSDLWILAGVASIQELQGPIIPYRPGRADRDVSFCTPDGRLPDASKDQKHVRNIFNRMGFNDQEIVALLGAHALGRTHTDRSGYDGPWTFSPTVFTNDFFKLLLDEKWQWKKWDGPAQYEDKTTKSLMMLPTDLALVHDKNFKKWVQTYAKDNDAFFKDFSDALVKLFELGVPFPEGKERWIMKPTNN

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCAACGTTTCCCGTCAGTTCGCCCGCAGCGCTCTGCGCTCTTCTGCCCGCGGCGCTTTCGTTGCCGCTCCACGACAGGCCTTCCGCAGCCAGGGCCGCCGTTTCTACTCCTCC
GAACCCCTCAAGTCTGGCAGCTCCACTTGGATCTGGGTCTCTGGCCTGGTCGCTGCCGGCGCTGGTGGTGCCTGGTACTACACCCAGCAGGGTGGCGTTTCCGCCGGCTCGGCCCCCAAG
GTTATCACCAACCCCACCAAGGAGGACTACCAGGCCGTCTACGACGACATTGCTGCTCGGCTCATCGAGCACGACGACTATGAAGATGGCAGCTATGGCCCCGTCCTCCTTCGTCTCGCG
TGGCACGCCAGCGGCACCTACGACAAGGAGACCGGCACTGGTGGAAGCAACGGCGCCACCATGCGCTTCTCGCCTGAGGCCGACCACGGTGCCAATGCAGGTCTCAAGAACGCCCGTGAC
TTCCTTGAGCCCGTGAAGG
GTGAGTTCCGCAATGACCTGTCCCGTCAAACAAAGTCCACTATATGCTAACGCACACCGCAGAGAAGTTCCCTTGGATCACCTACTCCGATCTCTGGATCC
TCGCCGGTGTCGCTTCTATCCAGGAGCTTCAGGGTCCTATCATTCCTTACCGCCCCGGTCGTGCTGACCGCGACGTCTCCTTCTGTACCCCCGACGGACGCCTTCCCGATGCCTCCAAGG
ACCAGAAGCACGTCCGCAACATCTTCAACCGCATGGGCTTCAACGACCAGGAAATTGTCGCCCTCCTTGGTGCCCATGCCCTCGGCCGCACCCACACTGACCGCAGCGGCTATGACGGCC
CGTGGACCTTCTCTCCTACCGTGTTCACCAACGATTTCTTCAAGCTGCTCCTTGACGAGAAGTGGCAGTGGAAGAAGTGGGATGGTCCCGCCCAGTACGAGGACAAGACCACCAAGAGCC
TCATGATGCTTCCCACCGATCTTGCACTTGTCCACGACAAGAACTTCAAGAAGTGGGTCCAGACCTACGCAAAGGACAACGATGCTTTCTTCAAGGACTTCTCCGACGCTCTTGTCAAGC
TCTTTGAGCTGGGCGTCCCCTTCCCTGAGGGCAAGGAGCGTTGGATCATGAAGCCCACCAACAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCAACGTTTCCCGTCAGTTCGCCCGCAGCGCTCTGCGCTCTTCTGCCCGCGGCGCTTTCGTTGCCGCTCCACGACAGGCCTTCCGCAGCCAGGGCCGCCGTTTCTACTCCTCC
GAACCCCTCAAGTCTGGCAGCTCCACTTGGATCTGGGTCTCTGGCCTGGTCGCTGCCGGCGCTGGTGGTGCCTGGTACTACACCCAGCAGGGTGGCGTTTCCGCCGGCTCGGCCCCCAAG
GTTATCACCAACCCCACCAAGGAGGACTACCAGGCCGTCTACGACGACATTGCTGCTCGGCTCATCGAGCACGACGACTATGAAGATGGCAGCTATGGCCCCGTCCTCCTTCGTCTCGCG
TGGCACGCCAGCGGCACCTACGACAAGGAGACCGGCACTGGTGGAAGCAACGGCGCCACCATGCGCTTCTCGCCTGAGGCCGACCACGGTGCCAATGCAGGTCTCAAGAACGCCCGTGAC
TTCCTTGAGCCCGTGAAGG
AGAAGTTCCCTTGGATCACCTACTCCGATCTCTGGATCCTCGCCGGTGTCGCTTCTATCCAGGAGCTTCAGGGTCCTATCATTCCTTACCGCCCCGGTCGT
GCTGACCGCGACGTCTCCTTCTGTACCCCCGACGGACGCCTTCCCGATGCCTCCAAGGACCAGAAGCACGTCCGCAACATCTTCAACCGCATGGGCTTCAACGACCAGGAAATTGTCGCC
CTCCTTGGTGCCCATGCCCTCGGCCGCACCCACACTGACCGCAGCGGCTATGACGGCCCGTGGACCTTCTCTCCTACCGTGTTCACCAACGATTTCTTCAAGCTGCTCCTTGACGAGAAG
TGGCAGTGGAAGAAGTGGGATGGTCCCGCCCAGTACGAGGACAAGACCACCAAGAGCCTCATGATGCTTCCCACCGATCTTGCACTTGTCCACGACAAGAACTTCAAGAAGTGGGTCCAG
ACCTACGCAAAGGACAACGATGCTTTCTTCAAGGACTTCTCCGACGCTCTTGTCAAGCTCTTTGAGCTGGGCGTCCCCTTCCCTGAGGGCAAGGAGCGTTGGATCATGAAGCCCACCAAC
AACTAG

Retrieve as FASTA