Entry information : AalcCP01
Entry ID 10716
Creation 2012-03-08 (Christophe Dunand)
Last sequence changes 2012-03-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: AalcCP01
Name AalcCP01
Class Catalase peroxidase    [Orthogroup: CP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Acremonium
Organism Acremonium alcalophilum    [TaxId: 398408 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AalcCP01
start..stop
S start..stop
CgloCP02_Naragc5 1177 0 1..731 1..749
CgloCP02_ST23 1175 0 1..731 1..749
CgraCP01 1170 0 1..733 1..751
MacrCP01 1167 0 1..731 1..725
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 345061..345381 321 N° 2 345471..347375 1905  
join(345061..345381,345471..347375)


exon

Literature and cross-references AalcCP01
DNA ref. JGI genome:   scaffold_4 (345061..347375)
Cluster/Prediction ref. JGI gene:   2104763
Protein sequence: AalcCP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   742
PWM (Da):   %s   81164.77  
PI (pH):   %s   6.37
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAENKCPIHDVAGGGTKLNQWWPNALRLNILRQHTPVSNPLGADFDYAAAFNNLDYEALKKDIVAVMTDSKDWWPADFGHYGGLFIRMAWHSAGTYRVFDGRGGAGQGQQRFAPLNSWPDNVSLDKARRLLWPVKQKYGSKISWADLMVLTGNVALEDMGFKPLGFAGGRADTWEADESVYWGSETTWLGNEKRYDNSKDPHSRDLANPLAAAHMGLIYVNPEGPDGNPDPIAAARDIRTTFARMAMNDEETVALIAGGHAFGKTHGAGPADNVGAEPEAAPIHQQGLGWANKFGSGKGPDTITSGIEVTWTKTPTKWSHNFLEYLFKHDWELSKSPAGAHQWVAKNAEPIIPDAHDPNKKHLPKMLTTDLSLRYDPEYEKISRRFLENPDQFADAFARAWFKLTHRDMGPRARYLGPEIPSEVFVWQDPVPDVDHPLVDASDIAALKKEVLGLGIDPSRLVATAWASASTFRGSDKRGGANGARIRLAPQKDWEANNPPQLAKVLSALEGLQQRFNAQASGGKKISLADLIVLGGVAAVEKAARDAGHEVTVPFTPGRTDASQEQTDVESVGYLEPTADGFRNYGKSTDRVKTEQWLVDRAHLLNLSAPELTVLVGGLRALGANYDGSSHGVFTSRPGTLTNDFFVNLLDQETEWAPASEGDVDHFVGTDRKSGAKKWTATRVDLIFGSHAELRALAEAYGSADSAAKFVQHFVAAWDKVMNLDRFDLQKTAAPRPTSRL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGAGAACAAGTGCCCGATTCACGACGTCGCCGGAGGCGGCACCAAGCTGAACCAGTGGTGGCCCAACGCCCTCAGGCTGAACATCCTGCGCCAACACACCCCGGTGTCTAACCCT
CTGGGTGCCGACTTTGACTATGCCGCCGCTTTCAACAACCTTGACTACGAGGCCCTCAAGAAGGATATTGTCGCCGTCATGACCGACTCGAAGGACTGGTGGCCAGCCGACTTTGGCCAC
TACGGCGGTCTCTTCATCCGTATGGCTTGGCACAGCGCTGGCACCTACCGTGTCTTTGATGGCCGTGGTGGTGCAGGGCAA
GTCAGTAACCTCCTTTCCTCTCTCGTCTCTCGTCTCTCC
TCTCTCCTCCCTCCCTTCAACATACTGACAGACGCCCCCACCTCCTACAGGGTCAACAACGATTCGCCCCCCTCAACAGCTGGCCGGATAACGTTAGTCTCGACAAGGCTCGTCGTCTGC
TATGGCCCGTCAAGCAGAAATACGGAAGCAAGATCTCCTGGGCCGACCTTATGGTCCTCACCGGCAACGTCGCCCTCGAAGACATGGGCTTCAAGCCCCTTGGCTTCGCTGGCGGCCGCG
CTGACACCTGGGAGGCCGACGAGTCGGTCTACTGGGGCTCCGAGACCACCTGGCTCGGGAACGAGAAGCGTTATGACAACTCCAAGGACCCCCACAGCCGAGACCTCGCGAACCCCCTGG
CTGCCGCCCACATGGGTCTCATCTACGTCAACCCGGAGGGCCCCGACGGCAACCCGGATCCCATCGCCGCCGCCAGGGACATCCGCACCACTTTTGCCCGCATGGCCATGAATGACGAGG
AGACGGTCGCCCTCATCGCCGGTGGCCACGCTTTCGGCAAGACGCACGGCGCTGGGCCCGCCGACAACGTTGGTGCCGAGCCCGAAGCCGCCCCCATCCACCAGCAGGGTCTGGGCTGGG
CGAACAAGTTCGGCTCCGGCAAGGGTCCCGACACCATCACCAGCGGTATCGAGGTGACCTGGACCAAGACGCCGACCAAGTGGAGCCACAACTTCCTCGAGTACCTGTTCAAGCACGACT
GGGAGCTCAGCAAGAGCCCCGCCGGCGCTCACCAGTGGGTGGCCAAGAACGCCGAGCCCATCATCCCCGACGCCCACGACCCGAACAAGAAGCACCTGCCCAAGATGCTGACCACCGATC
TCTCCCTCCGCTACGACCCGGAGTACGAGAAGATTTCCCGCCGCTTCCTCGAGAACCCGGACCAGTTCGCCGACGCCTTCGCCCGCGCCTGGTTCAAGCTGACCCACCGTGACATGGGTC
CCCGAGCTCGCTACCTCGGCCCCGAGATCCCCTCCGAGGTGTTCGTCTGGCAGGATCCCGTCCCCGACGTCGACCATCCGCTCGTCGATGCAAGCGACATCGCCGCCCTGAAGAAAGAGG
TCCTCGGCCTCGGCATCGACCCCTCCAGGCTCGTGGCCACGGCCTGGGCGTCGGCCTCCACCTTCCGCGGCAGCGACAAGCGCGGCGGCGCCAACGGAGCACGCATCCGCCTGGCGCCAC
AGAAGGACTGGGAGGCCAACAACCCGCCCCAGCTGGCCAAGGTGCTCAGCGCCCTCGAGGGTCTGCAGCAGCGTTTCAACGCGCAGGCCTCGGGCGGCAAGAAGATCTCCCTCGCCGACC
TCATCGTCCTCGGCGGCGTCGCGGCCGTCGAAAAAGCCGCCCGCGACGCTGGCCACGAAGTCACCGTCCCCTTCACGCCGGGCCGCACCGACGCCTCGCAGGAACAGACCGACGTCGAGT
CGGTCGGCTACCTCGAGCCGACGGCCGACGGGTTCCGCAACTACGGCAAGTCGACGGACCGGGTCAAGACGGAGCAGTGGCTCGTCGACAGGGCGCACCTGCTGAACCTCTCGGCACCCG
AGCTCACGGTCCTGGTGGGCGGCCTGCGCGCCCTCGGCGCCAACTACGACGGGTCGTCGCACGGCGTCTTCACGTCCCGGCCGGGCACGCTGACCAACGACTTTTTCGTCAACTTGCTCG
ACCAAGAGACCGAGTGGGCGCCCGCTAGCGAGGGAGACGTGGACCACTTTGTCGGCACGGATCGCAAGAGCGGGGCGAAGAAGTGGACGGCCACGCGCGTCGACCTCATCTTTGGGTCGC
ATGCCGAGCTCCGCGCCCTTGCTGAGGCGTATGGTAGCGCCGACAGCGCGGCCAAGTTTGTCCAGCACTTTGTTGCCGCGTGGGACAAGGTGATGAACCTGGACCGCTTCGACCTGCAGA
AGACTGCTGCGCCGAGGCCTACCAGCCGCCTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGAGAACAAGTGCCCGATTCACGACGTCGCCGGAGGCGGCACCAAGCTGAACCAGTGGTGGCCCAACGCCCTCAGGCTGAACATCCTGCGCCAACACACCCCGGTGTCTAACCCT
CTGGGTGCCGACTTTGACTATGCCGCCGCTTTCAACAACCTTGACTACGAGGCCCTCAAGAAGGATATTGTCGCCGTCATGACCGACTCGAAGGACTGGTGGCCAGCCGACTTTGGCCAC
TACGGCGGTCTCTTCATCCGTATGGCTTGGCACAGCGCTGGCACCTACCGTGTCTTTGATGGCCGTGGTGGTGCAGGGCAA
GGTCAACAACGATTCGCCCCCCTCAACAGCTGGCCGGAT
AACGTTAGTCTCGACAAGGCTCGTCGTCTGCTATGGCCCGTCAAGCAGAAATACGGAAGCAAGATCTCCTGGGCCGACCTTATGGTCCTCACCGGCAACGTCGCCCTCGAAGACATGGGC
TTCAAGCCCCTTGGCTTCGCTGGCGGCCGCGCTGACACCTGGGAGGCCGACGAGTCGGTCTACTGGGGCTCCGAGACCACCTGGCTCGGGAACGAGAAGCGTTATGACAACTCCAAGGAC
CCCCACAGCCGAGACCTCGCGAACCCCCTGGCTGCCGCCCACATGGGTCTCATCTACGTCAACCCGGAGGGCCCCGACGGCAACCCGGATCCCATCGCCGCCGCCAGGGACATCCGCACC
ACTTTTGCCCGCATGGCCATGAATGACGAGGAGACGGTCGCCCTCATCGCCGGTGGCCACGCTTTCGGCAAGACGCACGGCGCTGGGCCCGCCGACAACGTTGGTGCCGAGCCCGAAGCC
GCCCCCATCCACCAGCAGGGTCTGGGCTGGGCGAACAAGTTCGGCTCCGGCAAGGGTCCCGACACCATCACCAGCGGTATCGAGGTGACCTGGACCAAGACGCCGACCAAGTGGAGCCAC
AACTTCCTCGAGTACCTGTTCAAGCACGACTGGGAGCTCAGCAAGAGCCCCGCCGGCGCTCACCAGTGGGTGGCCAAGAACGCCGAGCCCATCATCCCCGACGCCCACGACCCGAACAAG
AAGCACCTGCCCAAGATGCTGACCACCGATCTCTCCCTCCGCTACGACCCGGAGTACGAGAAGATTTCCCGCCGCTTCCTCGAGAACCCGGACCAGTTCGCCGACGCCTTCGCCCGCGCC
TGGTTCAAGCTGACCCACCGTGACATGGGTCCCCGAGCTCGCTACCTCGGCCCCGAGATCCCCTCCGAGGTGTTCGTCTGGCAGGATCCCGTCCCCGACGTCGACCATCCGCTCGTCGAT
GCAAGCGACATCGCCGCCCTGAAGAAAGAGGTCCTCGGCCTCGGCATCGACCCCTCCAGGCTCGTGGCCACGGCCTGGGCGTCGGCCTCCACCTTCCGCGGCAGCGACAAGCGCGGCGGC
GCCAACGGAGCACGCATCCGCCTGGCGCCACAGAAGGACTGGGAGGCCAACAACCCGCCCCAGCTGGCCAAGGTGCTCAGCGCCCTCGAGGGTCTGCAGCAGCGTTTCAACGCGCAGGCC
TCGGGCGGCAAGAAGATCTCCCTCGCCGACCTCATCGTCCTCGGCGGCGTCGCGGCCGTCGAAAAAGCCGCCCGCGACGCTGGCCACGAAGTCACCGTCCCCTTCACGCCGGGCCGCACC
GACGCCTCGCAGGAACAGACCGACGTCGAGTCGGTCGGCTACCTCGAGCCGACGGCCGACGGGTTCCGCAACTACGGCAAGTCGACGGACCGGGTCAAGACGGAGCAGTGGCTCGTCGAC
AGGGCGCACCTGCTGAACCTCTCGGCACCCGAGCTCACGGTCCTGGTGGGCGGCCTGCGCGCCCTCGGCGCCAACTACGACGGGTCGTCGCACGGCGTCTTCACGTCCCGGCCGGGCACG
CTGACCAACGACTTTTTCGTCAACTTGCTCGACCAAGAGACCGAGTGGGCGCCCGCTAGCGAGGGAGACGTGGACCACTTTGTCGGCACGGATCGCAAGAGCGGGGCGAAGAAGTGGACG
GCCACGCGCGTCGACCTCATCTTTGGGTCGCATGCCGAGCTCCGCGCCCTTGCTGAGGCGTATGGTAGCGCCGACAGCGCGGCCAAGTTTGTCCAGCACTTTGTTGCCGCGTGGGACAAG
GTGATGAACCTGGACCGCTTCGACCTGCAGAAGACTGCTGCGCCGAGGCCTACCAGCCGCCTTTGA

Retrieve as FASTA