Entry information : OsPrx62 (Os04g59200)
Entry ID 1072
Creation 2006-07-25 (Filippo Passardi)
Last sequence changes 2010-08-03 (Marie Brette (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-12-21 (Christophe Dunand)
Peroxidase information: OsPrx62 (Os04g59200)
Name (synonym) OsPrx62 (Os04g59200)
Class Class III peroxidase    [Orthogroup: Prx068]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Leaves
Seeds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx62
start..stop
S start..stop
OsPrx64 521 0 1..350 1..338
OsPrx63 488 7e-175 7..332 3..323
TaPrx66 430 6e-152 3..350 4..341
OsPrx61 426 1e-150 11..350 12..340
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35251507..35251749 243 N° 2 35250564..35251379 816  
complement(join(35250564..35251379,35251507..35251749))


exon

Literature and cross-references OsPrx62 (Os04g59200)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1N1
DNA ref. GenBank:   NC_008397.1 (35251749..35250567)
Protein sequence: OsPrx62 (Os04g59200)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   352 (321)
PWM (Da):   %s   37169.91 (34158.2)  
PI (pH):   %s   6.5 (5.73) Peptide Signal:   %s   cut: 32 range:32-352
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAVSRSGRAVAVLQLVSTVVLLLSPPPAAASRRDMSVDFHAASCPQLETIVRSAVQAALQREIALAAGLLRIFFHDCFPQGCDASVYLNATNPNTEQFPQGPNETLQPRALQLVEDIRAKVHAECGPTVSCADISALATRDAVVVSGGPSYAVPLGQQDSLAPASVDLVGDLPGPSTSRVQALIDLFATRGLGDPADLVALSGGHTVGRARCDFFRDRAGRQDDTFSKKLKLNCTKDPNRLQELDVITPDAFDNAYYIALTTGQGVFTSDMALMKNQTTASIVRQFAQDKAAFFDQFAKSMVKLSKVPRPGGNVGEIRRSCFLSNSNGPRLDLVVAAATDQDPGFAASASA*

Retrieve as FASTA  
Remarks chromosome 4. 19 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCAGTGAGCAGAAGCGGCCGCGCAGTGGCCGTCCTGCAGCTTGTCTCCACCGTCGTCCTCCTCCTCTCGCCACCACCAGCAGCTGCATCTCGCCGTGACATGTCTGTGGACTTC
CACGCTGCGTCGTGCCCGCAGCTGGAGACCATCGTGCGCTCCGCCGTGCAGGCGGCGCTCCAGCGGGAGATCGCCCTCGCCGCCGGTCTCCTCCGCATCTTCTTCCACGACTGCTTCCCA
CAG
GTCACCTCTAGCTACTCTACGTGCGCCCTTATTACTGTACTAATTAATACAGTACTGTGTTGTATGTATGTACGTATATAAGGTATAGGATCGGAGTACGTAACTAAATGGACATGT
ATACGTACAGGGGTGCGACGCGTCGGTATATCTGAATGCCACCAACCCCAACACGGAGCAGTTTCCCCAGGGACCCAACGAGACGCTGCAGCCGCGGGCGCTGCAGCTGGTGGAGGACAT
CCGCGCCAAGGTGCACGCCGAATGCGGTCCCACTGTCTCCTGCGCCGACATCTCCGCCCTCGCCACCCGCGACGCCGTCGTCGTCTCCGGCGGCCCCTCTTACGCCGTGCCACTCGGCCA
GCAAGACAGCCTCGCTCCGGCATCGGTGGATCTCGTCGGAGATCTCCCGGGCCCGAGCACCTCCAGAGTCCAGGCTCTCATCGACCTTTTCGCGACCAGGGGCCTGGGAGATCCTGCCGA
CCTGGTGGCGCTCTCCGGCGGCCACACCGTCGGGAGAGCACGCTGCGACTTCTTCCGTGACCGCGCGGGGCGCCAGGACGACACCTTCTCCAAGAAGCTGAAGTTGAACTGCACCAAGGA
CCCCAACCGGCTGCAGGAGCTTGACGTGATAACGCCCGACGCCTTCGACAACGCCTACTACATCGCGCTCACCACCGGCCAGGGTGTCTTCACTTCCGACATGGCGCTCATGAAGAACCA
GACCACGGCGTCCATCGTCAGGCAGTTCGCGCAGGACAAGGCCGCCTTCTTCGACCAGTTTGCCAAGTCCATGGTCAAGCTCAGCAAGGTACCCAGGCCCGGCGGGAACGTCGGCGAGAT
CCGCCGCAGCTGCTTCCTTTCCAACTCCAACGGACCACGCCTCGACCTCGTCGTCGCCGCCGCCACCGACCAAGACCCCGGTTTCGCTGCCTCTGCGTCTGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCAGTGAGCAGAAGCGGCCGCGCAGTGGCCGTCCTGCAGCTTGTCTCCACCGTCGTCCTCCTCCTCTCGCCACCACCAGCAGCTGCATCTCGCCGTGACATGTCTGTGGACTTC
CACGCTGCGTCGTGCCCGCAGCTGGAGACCATCGTGCGCTCCGCCGTGCAGGCGGCGCTCCAGCGGGAGATCGCCCTCGCCGCCGGTCTCCTCCGCATCTTCTTCCACGACTGCTTCCCA
CAG
GGGTGCGACGCGTCGGTATATCTGAATGCCACCAACCCCAACACGGAGCAGTTTCCCCAGGGACCCAACGAGACGCTGCAGCCGCGGGCGCTGCAGCTGGTGGAGGACATCCGCGCC
AAGGTGCACGCCGAATGCGGTCCCACTGTCTCCTGCGCCGACATCTCCGCCCTCGCCACCCGCGACGCCGTCGTCGTCTCCGGCGGCCCCTCTTACGCCGTGCCACTCGGCCAGCAAGAC
AGCCTCGCTCCGGCATCGGTGGATCTCGTCGGAGATCTCCCGGGCCCGAGCACCTCCAGAGTCCAGGCTCTCATCGACCTTTTCGCGACCAGGGGCCTGGGAGATCCTGCCGACCTGGTG
GCGCTCTCCGGCGGCCACACCGTCGGGAGAGCACGCTGCGACTTCTTCCGTGACCGCGCGGGGCGCCAGGACGACACCTTCTCCAAGAAGCTGAAGTTGAACTGCACCAAGGACCCCAAC
CGGCTGCAGGAGCTTGACGTGATAACGCCCGACGCCTTCGACAACGCCTACTACATCGCGCTCACCACCGGCCAGGGTGTCTTCACTTCCGACATGGCGCTCATGAAGAACCAGACCACG
GCGTCCATCGTCAGGCAGTTCGCGCAGGACAAGGCCGCCTTCTTCGACCAGTTTGCCAAGTCCATGGTCAAGCTCAGCAAGGTACCCAGGCCCGGCGGGAACGTCGGCGAGATCCGCCGC
AGCTGCTTCCTTTCCAACTCCAACGGACCACGCCTCGACCTCGTCGTCGCCGCCGCCACCGACCAAGACCCCGGTTTCGCTGCCTCTGCGTCTGCTTGA

Retrieve as FASTA