Entry information : MlpCcP01 (Mella-CCP1)
Entry ID 10721
Creation 2012-03-08 (Christophe Dunand)
Last sequence changes 2012-03-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: MlpCcP01 (Mella-CCP1)
Name (synonym) MlpCcP01 (Mella-CCP1)
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Basidiomycota Melampsoraceae Melampsora
Organism Melampsora laricis-populina    [TaxId: 203908 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MlpCcP01
start..stop
S start..stop
CqueCcP01 579 0 1..314 1..314
PgrCcP01 533 0 1..314 1..314
PUtriCcP01 521 0 1..314 1..314
MvioCcP01 422 2e-150 1..290 1..283
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 581175..581325 151 N° 2 580932..581093 162 N° 3 580659..580861 203 N° 4 580543..580590 48
N° 5 580340..580462 123 N° 6 580012..580269 258  
complement(join(580012..580269,580340..580462,580543..580590,580659..580861,5809 32..581093,581175..581325))


exon

Literature and cross-references MlpCcP01 (Mella-CCP1)
DNA ref. JGI genome:   scaffold_28 (581325..580012)
Cluster/Prediction ref. JGI gene:   78292
Protein sequence: MlpCcP01 (Mella-CCP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315
PWM (Da):   %s   34806.03  
PI (pH):   %s   5.27
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSEKFDYEAVRQSIRKILTQPGYDNYEEGTKNTAGPILVRLAWHAAGTYDKETDTGGSDGAGMRYEAEGGDPANAGLQHARVFLEPIKEEHPWITYADLWTLAGVVAIEAMGGPKVPWKSGRTDFVDDTKCAPRGRLPDASQAHDHLRSVFYRMGFNDQEIVALSGAHNLKCHSDRSGYEGPWVNNPTRFSNQYFKLLKKLEWKKKEWTGPEQYVNSDFGDELMMLPTDRALLADPSFAVWVDKYADDRDLFFADFAKAFDKLLELGVKRNQHGYEAADKKSGAPGAPGQTGPDCEADGLAKGNDARSDSKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTGAAAAATTTGACTACGAAGCTGTTCGTCAATCGATTCGAAAAATCCTCACTCAACCAGGTTACGACAACTATGAGGAAGGTACCAAGAACACAGCTGGGCCAATTCTGGTT
CGTTTAGCTTGGCATGCTGCTGGTACTTATG
GTCAGTAGACTCAAGAAGACCTCAGAAATATGCTTCAGACTGGATCACACGAGTCTGAAGCGATGTACCTTTCGTCTTCAGATAAAGAA
ACCGACACTGGTGGATCGGATGGAGCTGGGATGCGCTACGAGGCAGAGGGAGGAGATCCGGCTAACGCTGGGCTTCAACATGCCCGAGTGTTCCTCGAGCCTATCAAAGAGGAACACCCT
TGGATCACATATGCTGACTTATGGACGCTAGCAG
GTGAGAAACCAACATGACTTTATCCCAAGTTTAAATATTAGCACTGATCGAGCGTGTTATTGGAACCCAGGCGTTGTGGCAATAGA
AGCCATGGGTGGCCCTAAAGTTCCTTGGAAATCAGGGAGAACTGACTTTGTTGATGATACCAAGTGTGCCCCAAGAGGCCGTTTACCCGACGCATCTCAAGCTCATGATCACCTTCGGAG
CGTATTTTATCGAATGGGCTTCAACGATCAAGAGATCGTTGCCTTATCTGGTGCTCATAACTTGGGT
GTTCGTCGAAGATAACTTTACTCTATCATTACCCAATGACTCTGACGTTGTCT
GTTTTCTCATAACAGAAATGTCACTCCGATCGTTCCGGATATGAGGGACCTTGGGTCAACAACGTGAGCTAATCGCTCTGCTGTTAAACTTGCTCAATGGAATGATGTCAGTCTAACATT
GGTTTACTCCTCAAAACCTTTAGCCTACCCGATTCAGCAACCAATACTTCAAGTTACTCAAGAAATTGGAGTGGAAGAAGAAAGAATGGACAGGTCCTGAGCAGTACGTCAACTCAGACT
TTGGTGATGAGTTGATGATGCTTCCA
GTAAGTTGTACTCTCACTTCTAAACGAGAAAAATCAAGTTGGCTAAAGTTATGTATCATGTCTATGCTAGACCGATCGGGCATTACTCGCTGAT
CCATCATTCGCCGTATGGGTTGACAAATATGCCGATGACAGAGATCTTTTCTTCGCAGACTTTGCCAAGGCCTTCGATAAATTATTAGAACTAGGCGTTAAAAGAAATCAACACGGTTAT
GAAGCAGCTGATAAAAAATCTGGTGCTCCAGGTGCACCAGGTCAAACTGGACCAGATTGTGAAGCTGATGGATTGGCTAAAGGTAATGATGCTAGAAGTGATTCTAAACTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTGAAAAATTTGACTACGAAGCTGTTCGTCAATCGATTCGAAAAATCCTCACTCAACCAGGTTACGACAACTATGAGGAAGGTACCAAGAACACAGCTGGGCCAATTCTGGTT
CGTTTAGCTTGGCATGCTGCTGGTACTTATG
ATAAAGAAACCGACACTGGTGGATCGGATGGAGCTGGGATGCGCTACGAGGCAGAGGGAGGAGATCCGGCTAACGCTGGGCTTCAACAT
GCCCGAGTGTTCCTCGAGCCTATCAAAGAGGAACACCCTTGGATCACATATGCTGACTTATGGACGCTAGCAG
GCGTTGTGGCAATAGAAGCCATGGGTGGCCCTAAAGTTCCTTGGAAA
TCAGGGAGAACTGACTTTGTTGATGATACCAAGTGTGCCCCAAGAGGCCGTTTACCCGACGCATCTCAAGCTCATGATCACCTTCGGAGCGTATTTTATCGAATGGGCTTCAACGATCAA
GAGATCGTTGCCTTATCTGGTGCTCATAACTTGGGT
AAATGTCACTCCGATCGTTCCGGATATGAGGGACCTTGGGTCAACAACCCTACCCGATTCAGCAACCAATACTTCAAGTTACTC
AAGAAATTGGAGTGGAAGAAGAAAGAATGGACAGGTCCTGAGCAGTACGTCAACTCAGACTTTGGTGATGAGTTGATGATGCTTCCA
ACCGATCGGGCATTACTCGCTGATCCATCATTC
GCCGTATGGGTTGACAAATATGCCGATGACAGAGATCTTTTCTTCGCAGACTTTGCCAAGGCCTTCGATAAATTATTAGAACTAGGCGTTAAAAGAAATCAACACGGTTATGAAGCAGCT
GATAAAAAATCTGGTGCTCCAGGTGCACCAGGTCAAACTGGACCAGATTGTGAAGCTGATGGATTGGCTAAAGGTAATGATGCTAGAAGTGATTCTAAACTTTAG

Retrieve as FASTA