Entry information : SrosCcP02 (Sporo-CCP2)
Entry ID 10724
Creation 2012-03-08 (Christophe Dunand)
Last sequence changes 2012-03-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-27 (Catherine Mathe (Scipio))
Peroxidase information: SrosCcP02 (Sporo-CCP2)
Name (synonym) SrosCcP02 (Sporo-CCP2)
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Basidiomycota Sporobolomyces
Organism Sporobolomyces roseus    [TaxId: 40563 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SrosCcP02
start..stop
S start..stop
RgraCcP01 491 2e-177 2..301 5..304
RmucCcP1_C2.5t1 471 6e-170 2..301 4..302
MvioCcP01 469 7e-169 10..290 2..281
CqueCcP01 421 6e-150 12..290 3..288
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18003..18133 131 N° 2 18230..18301 72 N° 3 18374..18403 30 N° 4 18480..18648 169
N° 5 18746..19003 258 N° 6 19100..19273 174 N° 7 19378..19449 72  
join(18003..18133,18230..18301,18374..18403,18480..18648,18746..19003,19100..192 73,19378..19449)


exon

Literature and cross-references SrosCcP02 (Sporo-CCP2)
DNA ref. JGI genome:   scaffold_5 (18003..19449)
Cluster/Prediction ref. JGI gene:   4970 [Incorrect prediction]
Protein sequence: SrosCcP02 (Sporo-CCP2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   301
PWM (Da):   %s   33504.52  
PI (pH):   %s   5.3
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPAPSPNSSSSSNKGDYEAVKRAIAKIIPQKGYDDGSAGPVLVRLAWHASGTYDAETKTGGSNGAGMRYECEGGDPANAGLEHARLFLEPIKEQFPWITYADLWTLAGATAIEEMGGPKIKWKPGRTDFVDDSCPPRGRLPDGAQAEEHLRFIFYRMGFNDQEIVALSGAHSLGRCHADRSGFEGPWSVTPTKFSTQYFKMLHKFKWEKKEWQGPIQYKNEDLGEELMMLPTDLALISDPAFKKWVEIYAGDRDKFYQDFANVFEKLIELGVDRSEPYEAAPQMSKEAGEKKEQEAKAKI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns). Incorrect prediction from JGI (PS and last exon are missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCGCACCGAGTCCGAATTCGTCTAGTTCGTCCAACAAGGGAGACTACGAAGCAGTCAAGCGCGCCATCGCAAAGATCATCCCCCAGAAAGGTTACGACGATGGGAGTGCAGGTCCA
GTCCTCGTCAG
GCAAGCGCCACCTCTCTCCCATCTTTTGCTCCCCCACTCGGCGGCGACTGACTCGCTCCCTCCTCGCTCCTCTCCGCTCTCTCTGTACGACTGCAGGTTGGCTTGGCAC
GCTAGCGGTACGTACGATGCAGAAACCAAGACGGGCGGTTCGAACGGTGCAGGAATGAG
GTGAGAGCCCAAACTACTCGCCCGAGTTCTTCCGCATGAAAAATCAAAACTCGAGCTCATC
TCTCTGTTCAGGTATGAATGCGAAGGAGGAGATCCCGCCAAGTGAGTGAACCCTCTTGTACACCCTCTCTCTCAACTACCGATCTCCGCGGCTCACGCGCTCGAATTCCGCAAACAGTGC
CGGTTTGGAACACGCGAGATTGTTCCTCGAACCGATCAAAGAACAGTTCCCTTGGATCACGTACGCCGATCTGTGGACTCTGGCCGGTGCGACTGCGATCGAAGAGATGGGAGGTCCCAA
GATCAAGTGGAAACCTGGAAGAACTGATTTCGTCGACGATTCGAAA
GTAAGAAAACTTTTGCCTTCTCTCTCTCTCTCTCTCTCTTTCTCTGTCGCTCCCAGTAAACCTGATCAGACCCC
TGACCTGTTCTCTGTGTGTCTAGTGTCCTCCTCGAGGTAGGTTACCAGACGGAGCTCAAGCCGAAGAACACCTCCGATTCATTTTCTACCGAATGGGGTTCAACGACCAAGAGATTGTCG
CCCTCTCGGGGGCCCATTCTCTCGGTCGCTGTCACGCCGACCGTTCCGGGTTCGAAGGACCTTGGTCGGTCACGCCGACAAAGTTCAGTACTCAGTACTTTAAAATGTTGCACAAGTTCA
AATGGGAGAAGAAGGAATGGCAAGGTCCGATTCAATACAAG
GTTAACTTTAGAAAACACCCTCTCTACTCTCTCTCTCATATTCTTTTCGCCTTCTGACCCTCTCGTGATTCTTTGGGTC
GGAATTATCAAATATAGAACGAAGATCTAGGAGAAGAATTAATGATGCTACCAACGGATTTGGCCTTGATCTCTGATCCCGCGTTCAAGAAATGGGTCGAGATCTACGCTGGAGACCGAG
ACAAGTTCTACCAAGATTTCGCAAACGTGTTTGAGAAATTGATCGAGTTGGGAGTCGATCGGAGTGAACCT
GTTGAGTTTCTTTCTTTTTTTTCTCTCACTCTCTCTCTCTCGTGGGAAT
CATCCATGTGAGGTGTGTATACTGACTCGTCTCCCTTCGAATTTGTCGGGCGTAGTACGAGGCTGCACCTCAAATGTCAAAGGAAGCGGGAGAGAAGAAGGAACAAGAAGCGAAAGCAAA
GATCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCGCACCGAGTCCGAATTCGTCTAGTTCGTCCAACAAGGGAGACTACGAAGCAGTCAAGCGCGCCATCGCAAAGATCATCCCCCAGAAAGGTTACGACGATGGGAGTGCAGGTCCA
GTCCTCGTCAG
GTTGGCTTGGCACGCTAGCGGTACGTACGATGCAGAAACCAAGACGGGCGGTTCGAACGGTGCAGGAATGAGGTATGAATGCGAAGGAGGAGATCCCGCCAATGCCGGT
TTGGAACACGCGAGATTGTTCCTCGAACCGATCAAAGAACAGTTCCCTTGGATCACGTACGCCGATCTGTGGACTCTGGCCGGTGCGACTGCGATCGAAGAGATGGGAGGTCCCAAGATC
AAGTGGAAACCTGGAAGAACTGATTTCGTCGACGATTCGAAA
TGTCCTCCTCGAGGTAGGTTACCAGACGGAGCTCAAGCCGAAGAACACCTCCGATTCATTTTCTACCGAATGGGGTTC
AACGACCAAGAGATTGTCGCCCTCTCGGGGGCCCATTCTCTCGGTCGCTGTCACGCCGACCGTTCCGGGTTCGAAGGACCTTGGTCGGTCACGCCGACAAAGTTCAGTACTCAGTACTTT
AAAATGTTGCACAAGTTCAAATGGGAGAAGAAGGAATGGCAAGGTCCGATTCAATACAAG
AACGAAGATCTAGGAGAAGAATTAATGATGCTACCAACGGATTTGGCCTTGATCTCTGAT
CCCGCGTTCAAGAAATGGGTCGAGATCTACGCTGGAGACCGAGACAAGTTCTACCAAGATTTCGCAAACGTGTTTGAGAAATTGATCGAGTTGGGAGTCGATCGGAGTGAACCT
TACGAG
GCTGCACCTCAAATGTCAAAGGAAGCGGGAGAGAAGAAGGAACAAGAAGCGAAAGCAAAGATCTAG

Retrieve as FASTA