Entry information : OsPrx64
Entry ID 1074
Creation 2006-07-25 (Filippo Passardi)
Last sequence changes 2006-07-25 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx64
Name OsPrx64
Class Class III peroxidase    [Orthogroup: Prx068]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx64
start..stop
S start..stop
OsPrx63 576 0 3..331 2..331
OsPrx62 521 0 1..338 1..350
HvPrx03 455 2e-162 5..338 6..338
TaPrx66 455 3e-162 13..338 14..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35281568..35281795 228 N° 2 35280705..35281493 789  
complement(join(35280705..35281493,35281568..35281795))


exon

Literature and cross-references OsPrx64
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q7XSU2
DNA ref. GenBank:   NC_008397.1 (35281795..35280708)
Protein sequence: OsPrx64
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (310)
PWM (Da):   %s   35938.38 (33178.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.35 (6.03) Peptide Signal:   %s   cut: 29 range:29-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAASRRLAVLELVSIVAVLLISSPAAAAELSVDFHAASCPQLESIVRSSVQAALQQEIALAAGLLRIFFHDCFPQGCDASVYLRGGSNSEQGMGPNLTLQPRALQLVEDIRAKVHAACGPTVSCADISALATRDAVVVSGGPSYAVPLGQKDSLAPASLDLVGDLPGPGTSRVQDLIDLFASRGLRDAADLVALSGGHTVGRTRCAFFDDRARRQDDTFSKKLALNCTKDPNRLQNLDVITPDAFDNAYYIALIHNQGVFTSDMALIKDRITAPIVRQFATDKAAFFTQFAKSMVKLSNVPRTDRNVGEIRRSCFRTNSQSLVDFATSDEEGFAASA*

Retrieve as FASTA  
Remarks chromosome 4. 8 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCAGCGAGCAGGAGACTGGCCGTCCTGGAGCTCGTCTCCATCGTCGCCGTCCTCCTCATCTCCTCACCAGCAGCAGCAGCAGAGTTGTCCGTGGACTTCCACGCGGCGTCGTGC
CCGCAGCTGGAGTCCATCGTGCGCTCCTCCGTGCAAGCCGCTCTCCAGCAGGAGATCGCCCTCGCCGCCGGCCTCCTCCGCATCTTCTTCCACGACTGCTTCCCGCAG
GCACGCACGCAA
GAACATTTGCACGTACCGACGAACAATGCTGTACTGAACTGAACATACATATATATATGCAGGGGTGCGATGCGTCGGTGTATCTGAGAGGAGGCAGCAACTCGGAGCAGGGCATGGGCC
CAAACCTCACGCTGCAGCCGCGGGCGCTGCAGCTGGTGGAGGACATCCGCGCCAAGGTGCACGCCGCCTGCGGCCCCACCGTCTCCTGCGCCGACATCTCCGCCCTCGCCACCCGCGACG
CTGTCGTCGTCTCCGGCGGCCCCTCTTACGCCGTGCCACTCGGCCAAAAAGACAGCCTCGCTCCGGCATCGTTGGACCTCGTCGGAGATCTCCCGGGCCCGGGCACCTCCAGAGTCCAGG
ATCTCATCGACCTTTTTGCAAGCAGGGGACTGCGGGACGCCGCCGACCTGGTGGCGCTCTCCGGCGGGCACACCGTCGGGAGGACACGCTGCGCCTTCTTCGATGACCGCGCCCGCCGCC
AGGACGACACCTTCTCCAAGAAGCTGGCGTTGAACTGCACCAAGGACCCCAACCGGCTGCAGAACCTGGACGTGATCACCCCCGACGCCTTCGACAACGCCTACTACATCGCGCTCATCC
ACAACCAGGGCGTCTTCACCTCCGACATGGCGCTCATCAAGGACCGGATCACGGCGCCCATCGTCAGGCAGTTCGCCACGGACAAGGCCGCCTTCTTCACGCAGTTCGCCAAGTCCATGG
TCAAACTAAGCAATGTGCCGAGGACTGACAGGAACGTCGGCGAGATCCGCCGCAGCTGCTTCAGGACCAACAGCCAGAGCCTCGTCGACTTCGCCACCAGCGATGAGGAGGGCTTCGCTG
CTTCTGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCAGCGAGCAGGAGACTGGCCGTCCTGGAGCTCGTCTCCATCGTCGCCGTCCTCCTCATCTCCTCACCAGCAGCAGCAGCAGAGTTGTCCGTGGACTTCCACGCGGCGTCGTGC
CCGCAGCTGGAGTCCATCGTGCGCTCCTCCGTGCAAGCCGCTCTCCAGCAGGAGATCGCCCTCGCCGCCGGCCTCCTCCGCATCTTCTTCCACGACTGCTTCCCGCAG
GGGTGCGATGCG
TCGGTGTATCTGAGAGGAGGCAGCAACTCGGAGCAGGGCATGGGCCCAAACCTCACGCTGCAGCCGCGGGCGCTGCAGCTGGTGGAGGACATCCGCGCCAAGGTGCACGCCGCCTGCGGC
CCCACCGTCTCCTGCGCCGACATCTCCGCCCTCGCCACCCGCGACGCTGTCGTCGTCTCCGGCGGCCCCTCTTACGCCGTGCCACTCGGCCAAAAAGACAGCCTCGCTCCGGCATCGTTG
GACCTCGTCGGAGATCTCCCGGGCCCGGGCACCTCCAGAGTCCAGGATCTCATCGACCTTTTTGCAAGCAGGGGACTGCGGGACGCCGCCGACCTGGTGGCGCTCTCCGGCGGGCACACC
GTCGGGAGGACACGCTGCGCCTTCTTCGATGACCGCGCCCGCCGCCAGGACGACACCTTCTCCAAGAAGCTGGCGTTGAACTGCACCAAGGACCCCAACCGGCTGCAGAACCTGGACGTG
ATCACCCCCGACGCCTTCGACAACGCCTACTACATCGCGCTCATCCACAACCAGGGCGTCTTCACCTCCGACATGGCGCTCATCAAGGACCGGATCACGGCGCCCATCGTCAGGCAGTTC
GCCACGGACAAGGCCGCCTTCTTCACGCAGTTCGCCAAGTCCATGGTCAAACTAAGCAATGTGCCGAGGACTGACAGGAACGTCGGCGAGATCCGCCGCAGCTGCTTCAGGACCAACAGC
CAGAGCCTCGTCGACTTCGCCACCAGCGATGAGGAGGGCTTCGCTGCTTCTGCTTGA

Retrieve as FASTA