Entry information : NtetPGHS01_2509
Entry ID 10740
Creation 2012-03-12 (Christophe Dunand)
Last sequence changes 2012-03-12 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2012-05-24 (Catherine Mathe)
Peroxidase information: NtetPGHS01_2509
Name NtetPGHS01_2509
Class H synthase    [Orthogroup: PGHS001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Sordariaceae Neurospora
Organism Neurospora tetrasperma    [TaxId: 40127 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NtetPGHS01_2509
start..stop
S start..stop
NcPGHS01 1295 0 1..650 1..651
NdisPGHS01 1241 0 1..650 1..648
SmaPGHS 1239 0 1..650 1..652
HpulPGHS 942 0 29..650 5..623
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 616280..616849 570 N° 2 615433..616117 685 N° 3 614658..615355 698  
complement(join(614658..615355,615433..616117,616280..616849))


exon

Literature and cross-references NtetPGHS01_2509
DNA ref. JGI genome:   scaffold_4 (616849..614658)
Cluster/Prediction ref. JGI gene:   109767
Protein sequence: NtetPGHS01_2509
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   651
PWM (Da):   %s   73311.82  
PI (pH):   %s   6.76
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPNTLSKPNGTTSAASSNGDDKGKKQVELQPSFTPTLLERLGITSFHLLNKLIPWYKLPGFIGAFNLAFLRIELRQYNLHDAYATSQAQGSSITDPLPNERYLGARHSDGKFNDLKQPKMGCTGMRFGRNFPREVCGKPSEAELMTPNPRMISERFMARKEGKFIPATTLNLLAAAWIQFQTHDWFFHEQDPNEKLNVPLSEDDKWLDQHMQLYATKPDEALDPSDIKCPGYKNLNTHWWDGSQIYGSSESVTQTLRNRHPDGKLSLDSRGREQFLPRDQVGNVLTGFTDKWWVGMEILHTLFALEHNAVCDALRKEYPDWSGDQIFDKARLVNCALMAKIHTVEWTPAILAHPALQIGMAANWWGIVGEKLTKIAGRLSKTSEIISGIPGSGAEQDGTPYSLTEEFVSVYRMHSLMPETIAFFSATDGHHVTTIPVVDTTFTKSQTPFDDGLSFADVFYSFGINYPGAITNNNYPDFLRNLRTPDGQVRDLGTVDILRDRERGVPRYCEFRRMLRLSVPKTFEELTGGNKVLAKELAEAYNNDISLVDALVGSHSEPVIPGFGFSETAFRIFILMASRRLKSDRFIAGEWNEEMYTKVGFKWVQDSGMKDVLGRHFPELRETLKGSKNVFAPWEMKAGSKEYKGVETNV

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCAACACCCTCTCCAAACCAAACGGCACTACCTCTGCCGCCTCGTCCAATGGAGACGACAAGGGCAAGAAGCAGGTTGAACTCCAACCCTCCTTCACACCCACTCTCCTCGAACGC
CTCGGCATCACCTCCTTTCACCTTCTCAACAAGTTGATCCCATGGTACAAACTCCCCGGCTTCATCGGCGCCTTCAACCTGGCCTTTCTGCGCATCGAGCTCCGACAATACAACCTGCAC
GACGCCTATGCGACTTCCCAAGCCCAAGGCAGTTCCATCACCGACCCTCTTCCCAACGAACGATACCTGGGCGCCCGTCACTCCGATGGCAAGTTCAATGACTTGAAACAGCCAAAGATG
GGATGCACGGGCATGAGGTTCGGGAGGAATTTCCCGCGGGAGGTTTGTGGAAAACCCAGCGAAGCGGAGCTGATGACGCCGAATCCGAGGATGATTAGTGAGAGGTTTATGGCGAGGAAG
GAAGGGAAGTTCATCCCGGCGACGACACTGAATCTGTTGGCGGCGGCGTGGATCCAGTTCCAGACGCATGATTGGTTTTTCCATGAGCAG
GTATGTGACTTGTGAGACTTTTTCCCTTTG
GGAATGGGGACTTTACCGATCATGCATTGGTCGTGATCCTGTGTAACATCAGATGTTGCCAGTATTCCTGTGGCTTGGGCTCCTTCCTTCTTGATTCCGATCATTGGCTGACTTTCTCCG
GTTGTGTCTCAGGACCCCAACGAGAAGCTCAACGTCCCGCTCTCTGAGGACGACAAGTGGCTTGACCAGCACATGCAGTTATACGCCACCAAGCCAGATGAGGCTCTCGACCCATCCGAC
ATCAAGTGTCCCGGGTACAAGAACCTCAACACCCACTGGTGGGACGGATCACAAATCTACGGCTCCTCCGAGTCCGTAACACAGACGCTCCGCAACCGTCATCCAGACGGCAAGTTGTCC
CTGGACAGTCGCGGGCGTGAGCAATTTCTCCCTCGGGACCAGGTTGGAAATGTCTTGACGGGCTTCACCGACAAATGGTGGGTGGGAATGGAGATTCTGCACACGCTGTTTGCGCTGGAG
CACAATGCCGTTTGTGATGCGCTGCGCAAGGAGTATCCCGATTGGAGCGGAGACCAGATCTTTGACAAGGCGAGGCTGGTGAACTGTGCATTAATGGCCAAGATCCATACGGTCGAGTGG
ACACCGGCGATTCTAGCGCATCCGGCGCTGCAGATTGGAATGGCCGCCAACTGGTGGGGGATTGTCGGGGAGAAGTTGACCAAGATCGCGGGAAGACTGTCCAAGACGAGCGAGATCATT
AGTGGAATTCCCGGCAGCGGAGCGGAGCAGGATGGGACGCCGTACTCACTGACGGAGGAGTTTGTGTCAGTTTATCGGATGCATTCGCTGATGCCTG
GTTCGTGCTTTCTCCTCTTTTCC
AATTCCCTCGGTGTTATTTATGTACCTCCCACTAACTGCAGTGTCCGTCCGCAGAAACAATCGCCTTCTTCTCCGCCACCGACGGCCACCACGTCACCACCATCCCCGTGGTCGACACCA
CCTTCACCAAATCGCAAACCCCCTTTGACGACGGTCTCTCCTTCGCTGACGTCTTCTACTCCTTCGGCATCAACTACCCCGGCGCCATCACAAACAACAACTACCCCGATTTCTTACGCA
ACCTGCGCACTCCCGACGGCCAAGTCCGCGACCTCGGAACCGTAGACATTCTCCGCGACCGCGAGCGGGGCGTCCCTCGCTACTGCGAGTTCCGGCGTATGCTTCGTCTTTCGGTTCCCA
AGACCTTCGAAGAACTTACCGGCGGCAACAAGGTCCTAGCCAAAGAACTGGCAGAAGCCTACAACAACGACATCTCCCTTGTGGATGCTTTGGTTGGATCCCACTCGGAGCCGGTGATTC
CAGGGTTCGGATTCAGCGAGACGGCGTTCAGGATCTTCATTCTCATGGCGAGCAGGAGGTTGAAGAGCGATCGGTTCATTGCCGGCGAATGGAACGAGGAGATGTACACCAAGGTTGGGT
TCAAGTGGGTGCAGGATAGCGGGATGAAGGATGTGTTGGGAAGACATTTCCCGGAGTTGAGGGAGACGTTGAAGGGGAGCAAGAATGTGTTTGCGCCGTGGGAGATGAAGGCGGGGAGCA
AGGAGTACAAGGGCGTGGAGACGAATGTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCAACACCCTCTCCAAACCAAACGGCACTACCTCTGCCGCCTCGTCCAATGGAGACGACAAGGGCAAGAAGCAGGTTGAACTCCAACCCTCCTTCACACCCACTCTCCTCGAACGC
CTCGGCATCACCTCCTTTCACCTTCTCAACAAGTTGATCCCATGGTACAAACTCCCCGGCTTCATCGGCGCCTTCAACCTGGCCTTTCTGCGCATCGAGCTCCGACAATACAACCTGCAC
GACGCCTATGCGACTTCCCAAGCCCAAGGCAGTTCCATCACCGACCCTCTTCCCAACGAACGATACCTGGGCGCCCGTCACTCCGATGGCAAGTTCAATGACTTGAAACAGCCAAAGATG
GGATGCACGGGCATGAGGTTCGGGAGGAATTTCCCGCGGGAGGTTTGTGGAAAACCCAGCGAAGCGGAGCTGATGACGCCGAATCCGAGGATGATTAGTGAGAGGTTTATGGCGAGGAAG
GAAGGGAAGTTCATCCCGGCGACGACACTGAATCTGTTGGCGGCGGCGTGGATCCAGTTCCAGACGCATGATTGGTTTTTCCATGAGCAG
GACCCCAACGAGAAGCTCAACGTCCCGCTC
TCTGAGGACGACAAGTGGCTTGACCAGCACATGCAGTTATACGCCACCAAGCCAGATGAGGCTCTCGACCCATCCGACATCAAGTGTCCCGGGTACAAGAACCTCAACACCCACTGGTGG
GACGGATCACAAATCTACGGCTCCTCCGAGTCCGTAACACAGACGCTCCGCAACCGTCATCCAGACGGCAAGTTGTCCCTGGACAGTCGCGGGCGTGAGCAATTTCTCCCTCGGGACCAG
GTTGGAAATGTCTTGACGGGCTTCACCGACAAATGGTGGGTGGGAATGGAGATTCTGCACACGCTGTTTGCGCTGGAGCACAATGCCGTTTGTGATGCGCTGCGCAAGGAGTATCCCGAT
TGGAGCGGAGACCAGATCTTTGACAAGGCGAGGCTGGTGAACTGTGCATTAATGGCCAAGATCCATACGGTCGAGTGGACACCGGCGATTCTAGCGCATCCGGCGCTGCAGATTGGAATG
GCCGCCAACTGGTGGGGGATTGTCGGGGAGAAGTTGACCAAGATCGCGGGAAGACTGTCCAAGACGAGCGAGATCATTAGTGGAATTCCCGGCAGCGGAGCGGAGCAGGATGGGACGCCG
TACTCACTGACGGAGGAGTTTGTGTCAGTTTATCGGATGCATTCGCTGATGCCTG
AAACAATCGCCTTCTTCTCCGCCACCGACGGCCACCACGTCACCACCATCCCCGTGGTCGACACC
ACCTTCACCAAATCGCAAACCCCCTTTGACGACGGTCTCTCCTTCGCTGACGTCTTCTACTCCTTCGGCATCAACTACCCCGGCGCCATCACAAACAACAACTACCCCGATTTCTTACGC
AACCTGCGCACTCCCGACGGCCAAGTCCGCGACCTCGGAACCGTAGACATTCTCCGCGACCGCGAGCGGGGCGTCCCTCGCTACTGCGAGTTCCGGCGTATGCTTCGTCTTTCGGTTCCC
AAGACCTTCGAAGAACTTACCGGCGGCAACAAGGTCCTAGCCAAAGAACTGGCAGAAGCCTACAACAACGACATCTCCCTTGTGGATGCTTTGGTTGGATCCCACTCGGAGCCGGTGATT
CCAGGGTTCGGATTCAGCGAGACGGCGTTCAGGATCTTCATTCTCATGGCGAGCAGGAGGTTGAAGAGCGATCGGTTCATTGCCGGCGAATGGAACGAGGAGATGTACACCAAGGTTGGG
TTCAAGTGGGTGCAGGATAGCGGGATGAAGGATGTGTTGGGAAGACATTTCCCGGAGTTGAGGGAGACGTTGAAGGGGAGCAAGAATGTGTTTGCGCCGTGGGAGATGAAGGCGGGGAGC
AAGGAGTACAAGGGCGTGGAGACGAATGTGTAG

Retrieve as FASTA