Entry information : HpulPGHS
Entry ID 10744
Creation 2012-03-12 (Christophe Dunand)
Last sequence changes 2012-03-12 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-10-15 (Catherine Mathe (Scipio))
Peroxidase information: HpulPGHS
Name HpulPGHS
Class H synthase    [Orthogroup: PGHS001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Hysteriaceae Hysterium
Organism Hysterium pulicare    [TaxId: 100027 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HpulPGHS
start..stop
S start..stop
XparPGHS 1087 0 1..618 1..624
AtePGHS01 967 0 7..618 4..616
NcPGHS01 958 0 5..623 30..651
NtetPGHS01_2509 942 0 5..623 29..650
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 43366..43857 492 N° 2 43921..45312 1392  
join(43366..43857,43921..45312)


exon

Literature and cross-references HpulPGHS
DNA ref. JGI genome:   NODE_600_length_220857_cov_26.005596 (43366..45312)
Cluster/Prediction ref. JGI gene:   9197
Protein sequence: HpulPGHS
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   627
PWM (Da):   %s   70617.22  
PI (pH):   %s   6.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MESVVKPSYKPSLSDRLLVGFFHIVNKFIPWHKLPSLIGALNLDALRIELRQYNLHDGYASGTAQGNQTTEPMTDKRFEHARNSDGKFNSTELPLMGCTGMRFGRNFPRQLTPKPTEEELWNPNPRMLSERFMARKEFVPATTLNLLAAAWIQFQTHDWFFHESSDENYDISLPNGDTWPHGKMELPRTKPDEVLNATDIKCPGYKNTNTAWWDSSQIYGSSEAATQTLRNMHSDGKLLLTKEGREQFLPRDADGNPLTGFNNNWWIGMEMLHTLFALEHNTICDTVRRANPDWSGDKVFDKARLINCALMAKIHTVEWTPAILAHPTLKIAMNANWWGLVGESLTKMLGRISKTSEEISGIPGSGVDQFGVPYSLTEEFVSVYRMHSLIPDTIAFFDAEDGEHKSTIPVEDTLFTNAQQPLDDGLSFADAFYSFGINYPGAITNSNYPNFLRNLTTPDGLHRDMGTVDLLRDRERGVPRYNEFRRLLRMSAPKTFEELTGGNKALAADLSSAHNGNIELVDALVGSHSEPLPAGFGFSDTAFRIFILMASRRLKSDRFIAGQWNAETYTKEGLKWVQDSGMKDVLLRHFPELQEVLKESKNVFAPWGQLPKSKDYGGIETNAPKTK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTCAGTAGTAAAGCCCAGCTATAAGCCCAGCCTTAGCGATCGCTTGCTAGTTGGGTTCTTCCACATAGTCAACAAGTTCATCCCATGGCACAAGCTCCCAAGTTTAATCGGTGCT
CTCAACCTGGACGCTCTACGAATTGAGCTCCGCCAATACAATTTACACGATGGCTACGCTTCTGGGACGGCTCAAGGCAATCAGACTACCGAGCCTATGACCGACAAGCGCTTCGAGCAT
GCACGAAACTCAGATGGTAAATTCAATTCGACTGAACTGCCACTGATGGGATGCACCGGCATGCGATTTGGCCGCAATTTCCCCAGGCAGTTGACGCCGAAGCCGACGGAAGAAGAGCTG
TGGAATCCGAATCCAAGAATGTTGAGCGAGCGCTTTATGGCGCGGAAAGAGTTTGTACCAGCCACGACTTTGAATTTGTTGGCGGCGGCGTGGATTCAGTTTCAGACGCATGATTGGTTC
TTTCATGAAAGT
GTGCGTTGAACTCTTTCAAAAACCTCTTGCAATATACCGATGAAAATTGCTGATGGCTCACAGAGTGACGAAAATTATGACATCTCCCTTCCCAATGGCGACACCTGG
CCACACGGCAAAATGGAGCTACCACGTACGAAGCCGGATGAGGTTCTGAACGCGACCGATATCAAGTGTCCAGGATATAAGAACACGAACACGGCATGGTGGGACAGCTCTCAAATCTAT
GGGTCCAGCGAAGCCGCGACGCAGACTCTGCGAAATATGCATAGTGATGGCAAGCTGTTGCTCACCAAGGAAGGCCGCGAGCAATTCCTTCCTCGCGACGCCGACGGAAACCCACTCACT
GGATTCAACAATAATTGGTGGATAGGAATGGAGATGTTGCATACGCTCTTTGCGTTGGAGCATAATACGATCTGTGATACAGTGCGCCGTGCAAACCCAGATTGGAGTGGTGATAAGGTC
TTCGACAAAGCGCGGCTCATCAACTGCGCTCTCATGGCCAAGATTCATACTGTCGAATGGACACCTGCCATCCTAGCTCATCCCACTCTCAAAATAGCCATGAACGCAAACTGGTGGGGC
CTAGTCGGCGAATCCTTAACCAAGATGCTGGGCCGCATCTCAAAGACTAGTGAAGAAATCAGCGGCATTCCCGGCTCTGGAGTCGACCAATTCGGCGTGCCTTACTCACTCACCGAGGAA
TTCGTCTCAGTGTATAGAATGCACTCGCTCATCCCAGATACCATCGCCTTTTTCGACGCCGAGGATGGAGAGCACAAATCCACCATCCCCGTTGAGGACACGCTCTTCACAAATGCGCAG
CAACCGCTCGATGATGGCCTCTCCTTCGCAGACGCCTTCTACTCTTTTGGTATCAACTACCCAGGCGCAATCACCAACTCAAACTACCCAAACTTCCTCCGCAACTTAACCACACCCGAT
GGTCTACATCGCGACATGGGCACAGTCGACCTCCTCCGGGACCGCGAGCGCGGCGTCCCGCGATACAACGAGTTCCGCCGCCTCTTACGCATGTCCGCACCCAAGACATTCGAGGAACTG
ACAGGCGGCAATAAAGCTCTCGCAGCAGACCTCTCGTCCGCCCACAACGGCAACATCGAGCTTGTGGACGCCTTGGTCGGTTCACATAGCGAGCCCCTCCCCGCGGGCTTCGGCTTCAGC
GACACCGCGTTCCGGATCTTCATCCTCATGGCAAGCCGGCGTTTGAAGAGCGACCGGTTTATCGCTGGGCAGTGGAATGCGGAAACGTATACGAAGGAAGGGTTGAAGTGGGTGCAGGAT
TCCGGGATGAAGGATGTGCTTTTGAGGCATTTCCCTGAGTTGCAGGAGGTGTTGAAGGAGAGTAAGAATGTTTTTGCGCCGTGGGGTCAGTTGCCGAAGTCGAAGGATTATGGGGGTATT
GAGACGAATGCGCCGAAGACGAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTCAGTAGTAAAGCCCAGCTATAAGCCCAGCCTTAGCGATCGCTTGCTAGTTGGGTTCTTCCACATAGTCAACAAGTTCATCCCATGGCACAAGCTCCCAAGTTTAATCGGTGCT
CTCAACCTGGACGCTCTACGAATTGAGCTCCGCCAATACAATTTACACGATGGCTACGCTTCTGGGACGGCTCAAGGCAATCAGACTACCGAGCCTATGACCGACAAGCGCTTCGAGCAT
GCACGAAACTCAGATGGTAAATTCAATTCGACTGAACTGCCACTGATGGGATGCACCGGCATGCGATTTGGCCGCAATTTCCCCAGGCAGTTGACGCCGAAGCCGACGGAAGAAGAGCTG
TGGAATCCGAATCCAAGAATGTTGAGCGAGCGCTTTATGGCGCGGAAAGAGTTTGTACCAGCCACGACTTTGAATTTGTTGGCGGCGGCGTGGATTCAGTTTCAGACGCATGATTGGTTC
TTTCATGAAAGT
AGTGACGAAAATTATGACATCTCCCTTCCCAATGGCGACACCTGGCCACACGGCAAAATGGAGCTACCACGTACGAAGCCGGATGAGGTTCTGAACGCGACCGATATC
AAGTGTCCAGGATATAAGAACACGAACACGGCATGGTGGGACAGCTCTCAAATCTATGGGTCCAGCGAAGCCGCGACGCAGACTCTGCGAAATATGCATAGTGATGGCAAGCTGTTGCTC
ACCAAGGAAGGCCGCGAGCAATTCCTTCCTCGCGACGCCGACGGAAACCCACTCACTGGATTCAACAATAATTGGTGGATAGGAATGGAGATGTTGCATACGCTCTTTGCGTTGGAGCAT
AATACGATCTGTGATACAGTGCGCCGTGCAAACCCAGATTGGAGTGGTGATAAGGTCTTCGACAAAGCGCGGCTCATCAACTGCGCTCTCATGGCCAAGATTCATACTGTCGAATGGACA
CCTGCCATCCTAGCTCATCCCACTCTCAAAATAGCCATGAACGCAAACTGGTGGGGCCTAGTCGGCGAATCCTTAACCAAGATGCTGGGCCGCATCTCAAAGACTAGTGAAGAAATCAGC
GGCATTCCCGGCTCTGGAGTCGACCAATTCGGCGTGCCTTACTCACTCACCGAGGAATTCGTCTCAGTGTATAGAATGCACTCGCTCATCCCAGATACCATCGCCTTTTTCGACGCCGAG
GATGGAGAGCACAAATCCACCATCCCCGTTGAGGACACGCTCTTCACAAATGCGCAGCAACCGCTCGATGATGGCCTCTCCTTCGCAGACGCCTTCTACTCTTTTGGTATCAACTACCCA
GGCGCAATCACCAACTCAAACTACCCAAACTTCCTCCGCAACTTAACCACACCCGATGGTCTACATCGCGACATGGGCACAGTCGACCTCCTCCGGGACCGCGAGCGCGGCGTCCCGCGA
TACAACGAGTTCCGCCGCCTCTTACGCATGTCCGCACCCAAGACATTCGAGGAACTGACAGGCGGCAATAAAGCTCTCGCAGCAGACCTCTCGTCCGCCCACAACGGCAACATCGAGCTT
GTGGACGCCTTGGTCGGTTCACATAGCGAGCCCCTCCCCGCGGGCTTCGGCTTCAGCGACACCGCGTTCCGGATCTTCATCCTCATGGCAAGCCGGCGTTTGAAGAGCGACCGGTTTATC
GCTGGGCAGTGGAATGCGGAAACGTATACGAAGGAAGGGTTGAAGTGGGTGCAGGATTCCGGGATGAAGGATGTGCTTTTGAGGCATTTCCCTGAGTTGCAGGAGGTGTTGAAGGAGAGT
AAGAATGTTTTTGCGCCGTGGGGTCAGTTGCCGAAGTCGAAGGATTATGGGGGTATTGAGACGAATGCGCCGAAGACGAAGTAG

Retrieve as FASTA