Entry information : FoPGHS
Entry ID 10748
Creation 2012-03-12 (Christophe Dunand)
Last sequence changes 2012-03-12 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-06 (Catherine Mathe (Scipio))
Peroxidase information: FoPGHS
Name FoPGHS
Class H synthase    [Orthogroup: PGHS001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Fusarium
Organism Fusarium oxysporum    [TaxId: 5507 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FoPGHS
start..stop
S start..stop
GmoPGHS01 1294 0 1..641 28..665
GzPGHS01 1174 0 2..641 22..660
NhaePGHS 1065 0 4..641 31..676
RrufPGHS 791 0 7..637 13..623
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1228902..1229939 1038 N° 2 1228037..1228849 813 N° 3 1227909..1227983 75  
complement(join(1227909..1227983,1228037..1228849,1228902..1229939))


exon

Literature and cross-references FoPGHS
DNA ref. JGI genome:   Supercontig_2.13 (1229939..1227909)
Cluster/Prediction ref. JGI gene:   3896
Protein sequence: FoPGHS
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   641
PWM (Da):   %s   72632.85  
PI (pH):   %s   6.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MISLKPIFKSVYIRLWKFVNIFVHWHKLPTWLGVFNLLALRYELREKNLHDTYPNAEFQGTTADCPMKNSKFIANRNSDGDFNDLAQPKMGCAGMRFGRNVPRKYTTPPTQQELLTPNPRIISEKILARPEGQFKPAEIVNLLAAAWIQFQVHDWAQHFLVTNGDKDVEIPLDKADRWSERIMKIPRTKKDDALSQQDIETPAYTNECTHWWDASQIYGSTEAETKALRAQCDKSYPGQLHVTREDGVQFLPRSDDGIPKTGFRQNWWLGLELLHTLFALEHNAIATQLHLSNPSWSSDQIFDTARLINCALMAKIHTVEWTPGILQHPALQIGMNANWWGLLGDKLWHVFGRVFDNKSEVISGIPGSGVDHDNVPYCLTEEFVSVYRLHPLIPDNVAFFSIKDGQHKGTLPIKDVAFESARKPFDEDKSGLGLSFADVFYSFGVNYPGAIRAHNMPNFLRDLNIPGDKDFPQGRHLDLGTIDILRDRERGVPRYNAFRRLFHMAPAKSFLDLTGGDAKLAAELEDVYDGDLEAVDLLVGTLSEPLPKGFGFSDTAFRVFILMATRRIKSDRFLAGDGWCPEVYTREGINWVQNNTMKDVLCRHFPELAATLHNVKNAFAPWTKIGQTEAYAGPETNKAKN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns). Incorrect prediction from JGI (one extra intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCTCCCTCAAACCCATCTTCAAGTCCGTTTACATTCGTCTTTGGAAATTCGTCAACATCTTTGTCCACTGGCACAAGCTCCCCACATGGCTGGGCGTTTTCAATCTCCTCGCTCTT
CGATATGAACTCCGCGAGAAGAACCTTCACGACACCTACCCCAATGCTGAGTTCCAGGGCACTACAGCAGATTGCCCCATGAAGAACTCAAAGTTCATCGCGAATAGGAACTCAGATGGC
GATTTCAATGATCTGGCGCAACCAAAGATGGGGTGCGCTGGTATGAGATTTGGTCGAAATGTCCCGAGAAAATATACCACGCCGCCAACTCAGCAGGAGCTGCTTACGCCCAATCCAAGA
ATCATATCAGAAAAGATTCTTGCTAGACCTGAAGGCCAGTTCAAACCCGCCGAGATTGTCAATCTTCTCGCCGCAGCGTGGATCCAGTTCCAAGTTCATGATTGGGCTCAGCACTTCCTT
GTCACAAATGGTGATAAAGACGTTGAGATTCCTCTAGATAAAGCCGACAGGTGGTCTGAGCGCATCATGAAAATCCCCCGTACCAAGAAAGACGATGCCCTTTCGCAACAAGATATCGAG
ACACCTGCTTATACCAACGAGTGCACTCATTGGTGGGATGCCTCTCAGATCTATGGATCCACTGAAGCCGAGACGAAAGCTCTCAGAGCCCAGTGCGATAAATCATATCCCGGTCAACTC
CATGTAACGCGCGAAGATGGCGTGCAGTTCCTCCCTCGATCGGATGATGGAATTCCCAAGACTGGATTCAGACAAAACTGGTGGTTGGGGCTTGAACTTCTTCATACCCTATTTGCGCTG
GAGCATAACGCCATTGCCACGCAGCTTCATCTTTCGAACCCTAGTTGGTCGAGTGATCAGATCTTTGATACTGCGAGACTCATCAATTGTGCTCTTATGGCGAAGATTCATACTGTTGAG
TGGACACCTGGTATTCTGCAGCACCCGGCGCTGCAGATTGGAATGAATGCGAACTGGTGGGGACTTTTGGGTGACAAG
GTATGTCTTCTAACCCTGCTTATGATGATTGATTACTGACTG
GATTTAATAGCTCTGGCATGTCTTCGGCCGTGTCTTTGACAACAAATCAGAAGTCATTTCTGGTATTCCTGGCTCGGGTGTCGATCACGACAATGTCCCATACTGCCTTACAGAAGAATT
CGTCTCCGTCTACCGTCTTCATCCTCTCATTCCCGACAACGTAGCATTCTTCAGCATTAAAGATGGCCAACACAAGGGAACTTTGCCTATCAAAGACGTCGCTTTTGAGTCAGCCCGCAA
GCCCTTTGACGAAGACAAATCAGGTCTTGGCCTTTCCTTCGCTGACGTCTTCTATTCGTTTGGCGTCAACTACCCAGGTGCTATTCGAGCTCATAACATGCCGAACTTCCTACGAGACTT
GAATATCCCGGGTGATAAGGACTTTCCTCAAGGCCGACACTTGGATTTGGGAACAATTGACATTCTTCGTGATCGTGAGCGCGGCGTTCCTCGCTACAACGCTTTCCGACGCCTGTTTCA
CATGGCACCTGCAAAGAGCTTCCTTGATCTCACTGGCGGTGATGCCAAGTTGGCTGCTGAGTTGGAAGATGTTTACGATGGAGATCTTGAGGCTGTGGATCTTCTGGTTGGTACACTCAG
CGAGCCTCTGCCCAAGGGCTTTGGCTTCAGCGACACTGCCTTCCGCGTCTTTATCCTCATGGCCACCCGTCGCATCAAGTCTGATCGCTTCCTTGCCGGCGATGGTTGGTGCCCTGAGGT
GTACACCCGCGAGGGCATCAATTGGGTTCAGAATAACACGATGAAGGATGTTTTGTGTCGACACTTCCCGGAACTTGCTGCAACGCTGCACAATGTCAAGAAT
GTGAGTATTCTTTCTAG
TCACTATGATTACTCTGAAACTAACCGCAATAACAGGCTTTCGCCCCTTGGACGAAGATTGGTCAGACTGAGGCTTATGCGGGCCCAGAGACTAACAAAGCAAAGAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCTCCCTCAAACCCATCTTCAAGTCCGTTTACATTCGTCTTTGGAAATTCGTCAACATCTTTGTCCACTGGCACAAGCTCCCCACATGGCTGGGCGTTTTCAATCTCCTCGCTCTT
CGATATGAACTCCGCGAGAAGAACCTTCACGACACCTACCCCAATGCTGAGTTCCAGGGCACTACAGCAGATTGCCCCATGAAGAACTCAAAGTTCATCGCGAATAGGAACTCAGATGGC
GATTTCAATGATCTGGCGCAACCAAAGATGGGGTGCGCTGGTATGAGATTTGGTCGAAATGTCCCGAGAAAATATACCACGCCGCCAACTCAGCAGGAGCTGCTTACGCCCAATCCAAGA
ATCATATCAGAAAAGATTCTTGCTAGACCTGAAGGCCAGTTCAAACCCGCCGAGATTGTCAATCTTCTCGCCGCAGCGTGGATCCAGTTCCAAGTTCATGATTGGGCTCAGCACTTCCTT
GTCACAAATGGTGATAAAGACGTTGAGATTCCTCTAGATAAAGCCGACAGGTGGTCTGAGCGCATCATGAAAATCCCCCGTACCAAGAAAGACGATGCCCTTTCGCAACAAGATATCGAG
ACACCTGCTTATACCAACGAGTGCACTCATTGGTGGGATGCCTCTCAGATCTATGGATCCACTGAAGCCGAGACGAAAGCTCTCAGAGCCCAGTGCGATAAATCATATCCCGGTCAACTC
CATGTAACGCGCGAAGATGGCGTGCAGTTCCTCCCTCGATCGGATGATGGAATTCCCAAGACTGGATTCAGACAAAACTGGTGGTTGGGGCTTGAACTTCTTCATACCCTATTTGCGCTG
GAGCATAACGCCATTGCCACGCAGCTTCATCTTTCGAACCCTAGTTGGTCGAGTGATCAGATCTTTGATACTGCGAGACTCATCAATTGTGCTCTTATGGCGAAGATTCATACTGTTGAG
TGGACACCTGGTATTCTGCAGCACCCGGCGCTGCAGATTGGAATGAATGCGAACTGGTGGGGACTTTTGGGTGACAAG
CTCTGGCATGTCTTCGGCCGTGTCTTTGACAACAAATCAGAA
GTCATTTCTGGTATTCCTGGCTCGGGTGTCGATCACGACAATGTCCCATACTGCCTTACAGAAGAATTCGTCTCCGTCTACCGTCTTCATCCTCTCATTCCCGACAACGTAGCATTCTTC
AGCATTAAAGATGGCCAACACAAGGGAACTTTGCCTATCAAAGACGTCGCTTTTGAGTCAGCCCGCAAGCCCTTTGACGAAGACAAATCAGGTCTTGGCCTTTCCTTCGCTGACGTCTTC
TATTCGTTTGGCGTCAACTACCCAGGTGCTATTCGAGCTCATAACATGCCGAACTTCCTACGAGACTTGAATATCCCGGGTGATAAGGACTTTCCTCAAGGCCGACACTTGGATTTGGGA
ACAATTGACATTCTTCGTGATCGTGAGCGCGGCGTTCCTCGCTACAACGCTTTCCGACGCCTGTTTCACATGGCACCTGCAAAGAGCTTCCTTGATCTCACTGGCGGTGATGCCAAGTTG
GCTGCTGAGTTGGAAGATGTTTACGATGGAGATCTTGAGGCTGTGGATCTTCTGGTTGGTACACTCAGCGAGCCTCTGCCCAAGGGCTTTGGCTTCAGCGACACTGCCTTCCGCGTCTTT
ATCCTCATGGCCACCCGTCGCATCAAGTCTGATCGCTTCCTTGCCGGCGATGGTTGGTGCCCTGAGGTGTACACCCGCGAGGGCATCAATTGGGTTCAGAATAACACGATGAAGGATGTT
TTGTGTCGACACTTCCCGGAACTTGCTGCAACGCTGCACAATGTCAAGAAT
GCTTTCGCCCCTTGGACGAAGATTGGTCAGACTGAGGCTTATGCGGGCCCAGAGACTAACAAAGCAAAG
AACTGA

Retrieve as FASTA