Entry information : OsPrx67
Entry ID 1077
Creation 2006-06-26 (Filippo Passardi)
Last sequence changes 2006-06-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx67
Name OsPrx67
Class Class III peroxidase     [Orthogroup: Prx068]*
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx67
start..stop
S start..stop
ZmPrx44 423 3e-149 2..344 1..344
ZmPrx107 418 2e-147 2..344 1..344
SbPrx108 415 4e-146 17..344 19..341
SiPrx09 414 1e-145 17..344 25..343
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1984666..1984878 213 N° 2 1985019..1985852 834  
join(1984666..1984878,1985019..1985852)


exon

Literature and cross-references OsPrx67
Literature Passardi,F., Longet,D., Penel,C. and Dunand,C. The class III peroxidase multigenic family in rice and its
evolution in land plants Phytochemistry 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1M6
DNA ref. GenBank:   NC_008398.1 (1984666..1985849)
Protein sequence: OsPrx67
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (328)
PWM (Da):   %s   37401.12 (35349.0) Transmb domain:   %s   i5-22o
PI (pH):   %s   8.62 (8.55) Peptide Signal:   %s   cut: 21 range:21-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVKLVCFVVVVFMAAAAAMAGADRELKVGYYEKTCKDVEKIVNSIVVNSIKDNRGKGAGLVRLLFHDCFVRGCDASVLLEKSEMNRQPEKESPANIGIRGMDVIDAIKAVLEARCPNTVSCADIIAYAARDASRYLSHGGVDFPVPAGRLDGVVSRSRDADAFLPDAAANLTDLVRNFRRKNFTVEELVILSGAHSIGVTHCTSFAGRLTAPDAQINPGYRSLLVSKCGGVSPTPANNHVVVNNVRDEDGAAVARVMPGFAARVRKARDYLDNSYYHNNLAMAVTFHADWALLTGKEARGHVVEYAKNATLWNVDFGDALVKLSKLPMPAGSKGEIRAKCSAVNGYHH*

Retrieve as FASTA  
Remarks chromosome 5. No ESTs found.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGCTTGTGTGCTTTGTTGTGGTGGTGTTCATGGCGGCGGCGGCGGCGATGGCCGGAGCCGATCGCGAGCTGAAGGTTGGGTACTACGAGAAGACGTGCAAGGACGTGGAGAAG
ATCGTGAACTCCATCGTCGTCAACTCCATCAAGGACAACCGCGGCAAGGGCGCTGGCCTCGTCCGCCTCCTCTTCCACGACTGCTTCGTCAGG
GTAAGGATCGATCGAACTAGTCATTTG
ACCGAACGCCATGCGTGCATGCAATGCAATGCACGTAGAGCTCGCTCGCTCGCTCGCTAGGCAGCAATGGCGGGTTTGATGATTAATGGAGTTGCTTGCTTCGTCGCGTGCAGGGGTGTG
ACGCCTCCGTGCTTCTGGAGAAGAGCGAGATGAACAGGCAGCCGGAGAAGGAATCTCCGGCGAACATCGGGATCCGGGGGATGGACGTGATCGACGCGATCAAGGCGGTGCTGGAGGCGC
GGTGCCCCAACACGGTGTCGTGCGCCGACATCATCGCGTACGCGGCGCGCGACGCGTCCAGGTACCTCAGCCACGGCGGCGTCGACTTCCCCGTCCCTGCCGGCCGCCTCGACGGCGTGG
TCTCCCGCAGCCGCGACGCCGACGCGTTCCTCCCGGACGCCGCCGCAAACCTCACCGACCTCGTCCGCAACTTCCGCCGCAAGAACTTCACCGTGGAGGAGCTCGTCATCCTCTCCGGCG
CGCACTCCATCGGCGTCACCCACTGCACCTCCTTCGCCGGCCGCCTCACCGCCCCGGACGCCCAGATCAACCCGGGCTACCGCAGCCTCCTCGTCTCCAAGTGCGGCGGCGTGTCGCCGA
CGCCGGCCAACAACCACGTCGTGGTGAACAACGTGCGCGACGAGGACGGCGCCGCCGTGGCGAGGGTCATGCCGGGGTTTGCGGCGAGGGTGAGGAAGGCGAGGGACTACCTGGACAACA
GCTACTACCACAACAACCTCGCCATGGCGGTGACGTTCCACGCGGACTGGGCGCTGCTCACCGGGAAGGAGGCGCGCGGGCACGTCGTGGAGTACGCCAAGAACGCGACGCTGTGGAACG
TGGACTTCGGCGACGCGCTGGTGAAGCTGAGCAAGCTGCCCATGCCGGCGGGGAGCAAGGGGGAGATCAGGGCCAAGTGCAGCGCCGTCAACGGCTACCACCATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGCTTGTGTGCTTTGTTGTGGTGGTGTTCATGGCGGCGGCGGCGGCGATGGCCGGAGCCGATCGCGAGCTGAAGGTTGGGTACTACGAGAAGACGTGCAAGGACGTGGAGAAG
ATCGTGAACTCCATCGTCGTCAACTCCATCAAGGACAACCGCGGCAAGGGCGCTGGCCTCGTCCGCCTCCTCTTCCACGACTGCTTCGTCAGG
GGGTGTGACGCCTCCGTGCTTCTGGAG
AAGAGCGAGATGAACAGGCAGCCGGAGAAGGAATCTCCGGCGAACATCGGGATCCGGGGGATGGACGTGATCGACGCGATCAAGGCGGTGCTGGAGGCGCGGTGCCCCAACACGGTGTCG
TGCGCCGACATCATCGCGTACGCGGCGCGCGACGCGTCCAGGTACCTCAGCCACGGCGGCGTCGACTTCCCCGTCCCTGCCGGCCGCCTCGACGGCGTGGTCTCCCGCAGCCGCGACGCC
GACGCGTTCCTCCCGGACGCCGCCGCAAACCTCACCGACCTCGTCCGCAACTTCCGCCGCAAGAACTTCACCGTGGAGGAGCTCGTCATCCTCTCCGGCGCGCACTCCATCGGCGTCACC
CACTGCACCTCCTTCGCCGGCCGCCTCACCGCCCCGGACGCCCAGATCAACCCGGGCTACCGCAGCCTCCTCGTCTCCAAGTGCGGCGGCGTGTCGCCGACGCCGGCCAACAACCACGTC
GTGGTGAACAACGTGCGCGACGAGGACGGCGCCGCCGTGGCGAGGGTCATGCCGGGGTTTGCGGCGAGGGTGAGGAAGGCGAGGGACTACCTGGACAACAGCTACTACCACAACAACCTC
GCCATGGCGGTGACGTTCCACGCGGACTGGGCGCTGCTCACCGGGAAGGAGGCGCGCGGGCACGTCGTGGAGTACGCCAAGAACGCGACGCTGTGGAACGTGGACTTCGGCGACGCGCTG
GTGAAGCTGAGCAAGCTGCCCATGCCGGCGGGGAGCAAGGGGGAGATCAGGGCCAAGTGCAGCGCCGTCAACGGCTACCACCATTGA

Retrieve as FASTA