Entry information : MperAPx-CcP03
Entry ID 10775
Creation 2012-03-19 (Christophe Dunand)
Last sequence changes 2012-03-19 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-19 (Christophe Dunand)
Peroxidase information: MperAPx-CcP03
Name MperAPx-CcP03
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP004]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Marasmiaceae Moniliophthora
Organism Moniliophthora perniciosa    [TaxId: 153609 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MperAPx-CcP03
start..stop
S start..stop
MperAPx-CcP02 473 1e-164 1..470 70..497
MfiaAPx-CcP01 442 9e-153 1..470 68..480
GluxAPx-CcP05 403 6e-138 1..466 1..448
MfiaAPx-CcP03 381 1e-128 1..470 69..502
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1079..1153 75 N° 2 1212..1278 67 N° 3 1326..1635 310 N° 4 1691..1804 114
N° 5 1855..2032 178 N° 6 2091..2510 420 N° 7 2568..2819 252  
join(1079..1153,1212..1278,1326..1635,1691..1804,1855..2032,2091..2510,2568..281 9)


exon

Literature and cross-references MperAPx-CcP03
Protein ref. UniProtKB:   E2LZH2
DNA ref. GenBank:   ABRE01017663.1 (1079..2819)
Protein sequence: MperAPx-CcP03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   471
PWM (Da):   %s   50317.52  
PI (pH):   %s   9.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MANYDAEAEKGGLDGSIVYELHREQNKGVAMTSSLNDLVFFTSPATSLADTIAMGTVLAVASCGGPIIPFRAGRVDATSAGPETVPEPQEDLAAHTANFKRQGFSQQEMIGLVACGHSLGGVSRKDFPDIIHDPKVELVQFANTHQFDNKVVTDYLSGTTINPLVVGPNTTTNSDLRIFGSDGNSTMKNLASADNFSKTCATLYEKMINSVPKGTNLTEVIKPIEYKVLNPRLFPGKDGSLTFSTSLLLTQNPKRKITLHWTDRRNKGSVCSATTGCSVPHTHGRSTLTTVLASKLGKGNMVVYGFEAKVNATTSMSNFWFEVDEGNGSKPIIVDNGGKRYRINQDVVLFDRSRSSLAFGGSSTGLHRRGGGIGGPAPTLSYNIVVAARGGKHSNITAITYEPGNSPSNFKPIIKHTTLLPDSKLPPMAGFTFYSATVTYGNASLTHLDIVGDVCGKKYKQKFIDAADLG*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAATTACGACGCTGAGGCAGAAAAAGGTGGATTGGACGGGTCTATCGTGTACGAGTTGCATAGAGAACAGGTTCGCTTTTCAATCTGCTCTCTTTATGCAATATATATATCTCAT
CTCCTTGGCTTAGAATAAAGGCGTCGCAATGACCTCCTCACTTAATGACCTCGTCTTCTTTACAAGCCCAGCAACCAGCCGTGAGTACCCATCCCACTGCCTCATGTCCGTGCATAACAC
ATTCTAGTCGCCGATACTATCGCAATGGGAACTGTATTAGCAGTAGCTTCCTGTGGTGGACCCATTATTCCATTCCGCGCAGGCAGGGTTGATGCAACATCCGCCGGACCGGAAACTGTC
CCCGAACCCCAAGAAGACCTCGCAGCGCACACTGCCAACTTCAAGAGACAAGGATTCTCACAACAGGAGATGATTGGCCTCGTTGCATGCGGTCACTCTTTGGGTGGTGTCTCGAGGAAG
GATTTCCCTGATATCATTCATGATCCCAAGGTCGAGTTGGTCCAGTTCGCCAATACTCACCAGTTTGATAATAAGGT
GTAAGTGTTGAAGCTATGCTGCTGTGGAAAGTCTGTCTGATGT
TTTATTGCATAGCGTAACCGATTATCTATCTGGGACGACTATCAACCCTCTCGTTGTTGGACCCAACACGACGACAAATTCTGACTTGCGTATTTTCGGCAGTGATGGCAACTCCACCAT
GAAGAA
GTGAGCACCGGTTCCCTTCAGGGCTCTATCCTGTCTTAATGCCGTGCCAGCCTTGCTTCCGCAGACAATTTCAGCAAGACATGTGCCACGCTATATGAGAAGATGATCAATAGC
GTACCCAAGGGCACTAATCTCACAGAGGTCATTAAACCCATTGAATACAAGGTTCTCAATCCTAGGCTTTTCCCCGGCAAAGATGGTTCATTGACATTCAGTACATCACTTCGA
GTCAGT
CGGCCTTATCTATTCTCGATTGCTCTTTTGCTAAGACCTTCTGTTTGAACAGCTTCTCACCCAAAACCCCAAACGCAAAATCACCTTGCACTGGACCGACCGCCGCAACAAGGGCTCCGT
CTGCTCCGCCACCACTGGTTGCTCTGTACCTCACACCCACGGCCGTTCCACCCTGACCACAGTCCTAGCCAGCAAACTAGGAAAAGGCAATATGGTCGTGTACGGCTTCGAAGCCAAAGT
CAATGCTACGACTTCCATGTCAAATTTCTGGTTTGAAGTCGATGAAGGGAACGGTTCAAAACCCATCATCGTTGACAATGGCGGAAAACGGTACAGAATCAACCAAGATGTCGTTCTGTT
TGATCGTTCGAGGTCTTCACTGGCCTTTGGCGGCAGCAGCACCGGCTTGCACAGAAGAGGTGGCGGAATCGGAGGTCCGGCTCCTACACTCAGCTATAACATTGTCGTTGCG
GTTCGCCT
TGACTCTTCATTTGGTCTCTTTTCATGCTTTACTCACTCGCACCTGAAGGCCCGTGGTGGCAAGCACTCCAACATCACTGCCATTACCTACGAGCCAGGAAACTCGCCGTCAAATTTCAA
GCCAATCATCAAGCACACTACCCTTCTTCCGGACTCAAAGCTCCCGCCTATGGCTGGGTTCACATTCTACTCGGCGACAGTGACTTATGGGAATGCGAGTCTAACGCATCTGGATATCGT
CGGTGATGTTTGCGGAAAGAAGTACAAGCAGAAGTTTATTGATGCTGCCGATTTGGGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAATTACGACGCTGAGGCAGAAAAAGGTGGATTGGACGGGTCTATCGTGTACGAGTTGCATAGAGAACAGAATAAAGGCGTCGCAATGACCTCCTCACTTAATGACCTCGTCTTC
TTTACAAGCCCAGCAACCAGCC
TCGCCGATACTATCGCAATGGGAACTGTATTAGCAGTAGCTTCCTGTGGTGGACCCATTATTCCATTCCGCGCAGGCAGGGTTGATGCAACATCCGCC
GGACCGGAAACTGTCCCCGAACCCCAAGAAGACCTCGCAGCGCACACTGCCAACTTCAAGAGACAAGGATTCTCACAACAGGAGATGATTGGCCTCGTTGCATGCGGTCACTCTTTGGGT
GGTGTCTCGAGGAAGGATTTCCCTGATATCATTCATGATCCCAAGGTCGAGTTGGTCCAGTTCGCCAATACTCACCAGTTTGATAATAAGGT
CGTAACCGATTATCTATCTGGGACGACT
ATCAACCCTCTCGTTGTTGGACCCAACACGACGACAAATTCTGACTTGCGTATTTTCGGCAGTGATGGCAACTCCACCATGAAGAA
CCTTGCTTCCGCAGACAATTTCAGCAAGACATGT
GCCACGCTATATGAGAAGATGATCAATAGCGTACCCAAGGGCACTAATCTCACAGAGGTCATTAAACCCATTGAATACAAGGTTCTCAATCCTAGGCTTTTCCCCGGCAAAGATGGTTCA
TTGACATTCAGTACATCACTTCGA
CTTCTCACCCAAAACCCCAAACGCAAAATCACCTTGCACTGGACCGACCGCCGCAACAAGGGCTCCGTCTGCTCCGCCACCACTGGTTGCTCTGTA
CCTCACACCCACGGCCGTTCCACCCTGACCACAGTCCTAGCCAGCAAACTAGGAAAAGGCAATATGGTCGTGTACGGCTTCGAAGCCAAAGTCAATGCTACGACTTCCATGTCAAATTTC
TGGTTTGAAGTCGATGAAGGGAACGGTTCAAAACCCATCATCGTTGACAATGGCGGAAAACGGTACAGAATCAACCAAGATGTCGTTCTGTTTGATCGTTCGAGGTCTTCACTGGCCTTT
GGCGGCAGCAGCACCGGCTTGCACAGAAGAGGTGGCGGAATCGGAGGTCCGGCTCCTACACTCAGCTATAACATTGTCGTTGCG
GCCCGTGGTGGCAAGCACTCCAACATCACTGCCATT
ACCTACGAGCCAGGAAACTCGCCGTCAAATTTCAAGCCAATCATCAAGCACACTACCCTTCTTCCGGACTCAAAGCTCCCGCCTATGGCTGGGTTCACATTCTACTCGGCGACAGTGACT
TATGGGAATGCGAGTCTAACGCATCTGGATATCGTCGGTGATGTTTGCGGAAAGAAGTACAAGCAGAAGTTTATTGATGCTGCCGATTTGGGTTGA

Retrieve as FASTA