Entry information : OsPrx68
Entry ID 1078
Creation 2006-07-25 (Filippo Passardi)
Last sequence changes 2006-07-25 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx68
Name OsPrx68
Class Class III peroxidase    [Orthogroup: Prx126]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx68
start..stop
S start..stop
SbPrx111 446 9e-159 3..335 1..323
SiPrx104 445 2e-158 32..335 22..323
SiPrx106 444 3e-158 3..332 1..324
SiPrx102 441 7e-157 1..328 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1990180..1990428 249 N° 2 1990768..1991526 759  
join(1990180..1990428,1990768..1991526)


exon

Literature and cross-references OsPrx68
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q6AVZ5
DNA ref. GenBank:   NC_008398.1 (1990180..1991523)
Protein sequence: OsPrx68
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (301)
PWM (Da):   %s   35076.21 (31724.6) Transmb domain:   %s   i12-34o
PI (pH):   %s   6.87 (6.12) Peptide Signal:   %s   cut: 35 range:35-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMATAACRRPAVMLMAFAMAAAVTMSSVPPASGTTTLQYDFYSSSCPKAEETVRNVVEPMIFNDPTMGAAFIRLFFHDCFVRGCDASILLDPTSRNTQPEKTAIPLRGYDAVNKIKAAVEAVCPGKVSCADILAFAARDSAVVNGNFAFAMPSGRRDGTASSASDVARFIPSPAFHLQDLVDSFAAKGLTADDLVILSGAHSFGLTHCAFVTGRLYPTVDPTMNATFAAALKKLCPPPASGGGGRAVSNNQVTDPNVLSNQYFKNVAAGEVMFTSDQTLTSRDDTKAMVDDNAANPVAWMARFAAAMVKMGGVEVLTGNAGEVRKVCFATNTAS*

Retrieve as FASTA  
Remarks chromosome 5. 5 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATGGCGACAGCAGCATGCAGAAGGCCTGCAGTGATGCTCATGGCGTTCGCCATGGCGGCTGCGGTGACGATGAGCTCCGTGCCGCCGGCGTCGGGGACGACGACGCTGCAGTAC
GACTTCTACTCGTCGTCGTGCCCGAAAGCCGAGGAGACGGTGAGGAACGTCGTCGAGCCGATGATCTTCAACGACCCCACCATGGGCGCCGCCTTCATCCGCCTCTTCTTCCACGACTGC
TTCGTCAGG
GTACGTACAAAACTATCATTTATAAAACATATAAGTTTCGTAGTAAATTCATCAACGTGTCATATTTGGATTGGTTTAATTCAATTTAATAATAACAATTTACATTCATGT
TTACCCAACACTATTTCTTTAACTATGTTTTAACAATAAAATTCATTCCAGTCTTTATTTTAAAGAAAGTACATCCAATTATTACACATATATTACAAATCAAATGACTCGAATTATAAA
ATCATAGCTCGATTAAAATCAAGAAAACCACTTAAACTACCTGTTTGAAGACAAAGGTTAACTATCTAATTAAAAAAGTAATTAATGAAATTGTATTTGCAATAATAGGGTTGTGACGCG
TCCATCCTGCTGGACCCGACGAGCAGAAACACGCAGCCGGAGAAGACGGCGATCCCGCTGCGCGGCTACGACGCCGTGAACAAGATCAAGGCCGCCGTCGAGGCCGTCTGCCCCGGCAAG
GTCTCCTGCGCCGACATCCTCGCCTTCGCCGCGCGCGACTCCGCCGTCGTCAACGGCAACTTCGCCTTCGCCATGCCCTCCGGCCGCCGCGACGGCACCGCCTCCTCCGCCTCCGACGTC
GCCCGGTTCATCCCGTCCCCGGCGTTCCACCTCCAGGACCTCGTCGACAGCTTCGCCGCCAAGGGCCTCACCGCCGACGACCTCGTCATCCTCTCCGGCGCCCACTCCTTCGGCCTCACC
CACTGCGCCTTCGTCACCGGCAGGCTCTACCCCACCGTCGACCCCACCATGAACGCCACGTTCGCCGCGGCGCTCAAGAAGCTGTGCCCGCCGCCGGCGAGCGGCGGCGGCGGGAGGGCG
GTGAGCAACAACCAGGTGACCGACCCCAACGTGCTGAGCAACCAGTACTTCAAGAACGTGGCCGCCGGGGAGGTGATGTTCACGTCGGACCAGACGCTGACGAGCCGCGACGACACCAAG
GCGATGGTCGACGACAACGCCGCCAACCCGGTGGCGTGGATGGCGAGGTTCGCGGCGGCGATGGTGAAGATGGGCGGCGTCGAGGTGCTCACCGGGAACGCCGGCGAGGTCAGGAAGGTC
TGCTTCGCCACCAACACGGCGAGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATGGCGACAGCAGCATGCAGAAGGCCTGCAGTGATGCTCATGGCGTTCGCCATGGCGGCTGCGGTGACGATGAGCTCCGTGCCGCCGGCGTCGGGGACGACGACGCTGCAGTAC
GACTTCTACTCGTCGTCGTGCCCGAAAGCCGAGGAGACGGTGAGGAACGTCGTCGAGCCGATGATCTTCAACGACCCCACCATGGGCGCCGCCTTCATCCGCCTCTTCTTCCACGACTGC
TTCGTCAGG
GGTTGTGACGCGTCCATCCTGCTGGACCCGACGAGCAGAAACACGCAGCCGGAGAAGACGGCGATCCCGCTGCGCGGCTACGACGCCGTGAACAAGATCAAGGCCGCCGTC
GAGGCCGTCTGCCCCGGCAAGGTCTCCTGCGCCGACATCCTCGCCTTCGCCGCGCGCGACTCCGCCGTCGTCAACGGCAACTTCGCCTTCGCCATGCCCTCCGGCCGCCGCGACGGCACC
GCCTCCTCCGCCTCCGACGTCGCCCGGTTCATCCCGTCCCCGGCGTTCCACCTCCAGGACCTCGTCGACAGCTTCGCCGCCAAGGGCCTCACCGCCGACGACCTCGTCATCCTCTCCGGC
GCCCACTCCTTCGGCCTCACCCACTGCGCCTTCGTCACCGGCAGGCTCTACCCCACCGTCGACCCCACCATGAACGCCACGTTCGCCGCGGCGCTCAAGAAGCTGTGCCCGCCGCCGGCG
AGCGGCGGCGGCGGGAGGGCGGTGAGCAACAACCAGGTGACCGACCCCAACGTGCTGAGCAACCAGTACTTCAAGAACGTGGCCGCCGGGGAGGTGATGTTCACGTCGGACCAGACGCTG
ACGAGCCGCGACGACACCAAGGCGATGGTCGACGACAACGCCGCCAACCCGGTGGCGTGGATGGCGAGGTTCGCGGCGGCGATGGTGAAGATGGGCGGCGTCGAGGTGCTCACCGGGAAC
GCCGGCGAGGTCAGGAAGGTCTGCTTCGCCACCAACACGGCGAGCTGA

Retrieve as FASTA