Entry information : PindCcP
Entry ID 10781
Creation 2012-03-19 (Christophe Dunand)
Last sequence changes 2012-03-19 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-19 (Christophe Dunand)
Peroxidase information: PindCcP
Name PindCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sebacinaceae Piriformospora
Organism Piriformospora indica    [TaxId: 65672 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PindCcP
start..stop
S start..stop
SverCcP01 602 0 2..391 5..392
SnivCcP01 526 0 31..389 6..367
PoCcP_PC9 516 0 42..391 21..375
SlacCcP01 514 0 37..388 17..371
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23009..23402 394 N° 2 22870..22951 82 N° 3 22650..22803 154 N° 4 22470..22603 134
N° 5 22280..22423 144 N° 6 22161..22232 72 N° 7 22030..22113 84 N° 8 21869..21980 112
complement(join(21869..21980,22030..22113,22161..22232,22280..22423,22470..22603 ,22650..22803,22870..22951,23009..23402))


exon

Literature and cross-references PindCcP
DNA ref. GenBank:   CAFZ01000037.1 (23402..21869)
Protein sequence: PindCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   391
PWM (Da):   %s   42996.64  
PI (pH):   %s   8.83
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLRSILPVLRGQCTSRTFSTTSRVATRTGSPFANVANARSKALVRPSSRGFATDSGASKGSGINVWIALLGIAGAGGAYYFYTNPKEAETALKSGTQSAKAAAGFTPKLEDYQKVYNTVAELLDEAGDYDDGSYGPVLVRLAWHASGTYDKETNTGGSNYATMRFAPESLHAANNGLAIARGVLEPVKQKYPWISYGDLWTLAGVAAIEASGPKIPWRAGRIDGFEKDVTPDGRLPDATQGADHLRNIFYRMGFNDQEIVALSGAHALGRCHTDRSGFEGPWTFSPVTFSNQYFALLWNEKWQWRKWNGPKQLEDKKTKSLMMLPTDYVLVTDKSFKKWTKAYADDESVFFKDFSAAFSRLLELGVPTTQWVTQTPWELKTLAEQEEKK

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTGCGCTCGATCCTCCCCGTTCTCCGCGGCCAATGCACGTCTAGGACGTTCTCTACGACGTCTCGTGTTGCGACGCGCACTGGCTCTCCCTTTGCCAACGTCGCCAACGCTCGT
TCAAAGGCCTTGGTTCGACCTTCGTCACGCGGTTTCGCCACGGACAGCGGTGCATCCAAGGGCTCGGGAATAAACGTCTGGATTGCTTTGCTCGGTATTGCCGGCGCTGGTGGTGCCTAT
TACTTCTACACCAACCCCAAGGAGGCCGAAACCGCGCTCAAGTCTGGAACGCAGTCTGCAAAGGCCGCTGCTGGCTTCACGCCAAAGCTTGAGGACTATCAAAAGGTCTACAACACGGTC
GCCGAACTCCTTGACGAGGCCGGCGATTATGACG
GTTAGTGGCTGCCGTGGCTGCGTCGACGACCTCTTCTTTGGCTAACAAGCGTACCAGATGGCTCATATGGCCCCGTTCTCGTCCGT
CTTGCGTGGCACGCCAGTGGAACGTACGACAAGGAGACGAATACTGGTGGCAG
GTATGCTGTCTTCTCGAAGAAGATCCGGTTCACACGGGACTGACTTGCCCCGCTTTTGATTCGCAGC
AACTATGCCACGATGCGCTTCGCGCCCGAATCTTTGCATGCGGCTAACAACGGTCTCGCCATTGCCCGCGGTGTGCTCGAGCCCGTAAAGCAAAAGTATCCTTGGATCAGCTATGGTGAC
CTTTGGACTCTGGCCGGTGTTGCCGCCATCCAG
GTTTGTGATTCTTGGTCCTATCGACGATCTCTCACCCCGGCTGTAGGAGGCTTCAGGACCGAAGATCCCCTGGCGTGCTGGTCGCAT
TGATGGTTTCGAAAAGGACGTAACTCCTGATGGACGTCTCCCCGACGCTACTCAGGGTGCTGATCATCTCCGGAACATCTTCTATCGCATGGG
GTGCGCCCACTCGCTCTGATTCAAGCC
TTTGGCTCACATTCCAAAGCTTTAACGATCAGGAAATTGTCGCTCTCTCTGGTGCTCACGCCCTCGGTCGTTGCCACACAGATAGGTCTGGTTTCGAAGGCCCTTGGACTTTCTCGCCGG
TCACCTTCTCCAACCAATACTTTGCCTTGCTCTGGAACGAGAA
GTGAGTATTAAATTTTCTCCGAGGACTACCCGCTGACGTCTTCAAAGGTGGCAATGGCGCAAGTGGAACGGACCCAA
GCAACTCGAGGACAAGAAAACTAAGAGCTTGATGATGTTGCC
GTAAGTTCTTCAAAGACTGCTCGAGAATCGTAATTCATAGTTGATAGGACCGACTACGTTCTCGTCACCGACAAGTCC
TTCAAGAAATGGACCAAGGCTTATGCTGATGACGAGTCTGTTTTCTTCAAAGA
GTGCGCATTTGATTGACAAATAGACGTGTCTACTGACCTCTTGCTTCAGTTTCTCTGCAGCCTTCTC
TCGTCTCCTCGAACTAGGTGTCCCCACTACCCAATGGGTCACCCAGACTCCATGGGAACTCAAGACACTTGCGGAGCAAGAAGAGAAGAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTGCGCTCGATCCTCCCCGTTCTCCGCGGCCAATGCACGTCTAGGACGTTCTCTACGACGTCTCGTGTTGCGACGCGCACTGGCTCTCCCTTTGCCAACGTCGCCAACGCTCGT
TCAAAGGCCTTGGTTCGACCTTCGTCACGCGGTTTCGCCACGGACAGCGGTGCATCCAAGGGCTCGGGAATAAACGTCTGGATTGCTTTGCTCGGTATTGCCGGCGCTGGTGGTGCCTAT
TACTTCTACACCAACCCCAAGGAGGCCGAAACCGCGCTCAAGTCTGGAACGCAGTCTGCAAAGGCCGCTGCTGGCTTCACGCCAAAGCTTGAGGACTATCAAAAGGTCTACAACACGGTC
GCCGAACTCCTTGACGAGGCCGGCGATTATGACG
ATGGCTCATATGGCCCCGTTCTCGTCCGTCTTGCGTGGCACGCCAGTGGAACGTACGACAAGGAGACGAATACTGGTGGCAGCAAC
TATGCCACGATGCGCTTCGCGCCCGAATCTTTGCATGCGGCTAACAACGGTCTCGCCATTGCCCGCGGTGTGCTCGAGCCCGTAAAGCAAAAGTATCCTTGGATCAGCTATGGTGACCTT
TGGACTCTGGCCGGTGTTGCCGCCATCCAG
GAGGCTTCAGGACCGAAGATCCCCTGGCGTGCTGGTCGCATTGATGGTTTCGAAAAGGACGTAACTCCTGATGGACGTCTCCCCGACGCT
ACTCAGGGTGCTGATCATCTCCGGAACATCTTCTATCGCATGGG
CTTTAACGATCAGGAAATTGTCGCTCTCTCTGGTGCTCACGCCCTCGGTCGTTGCCACACAGATAGGTCTGGTTTC
GAAGGCCCTTGGACTTTCTCGCCGGTCACCTTCTCCAACCAATACTTTGCCTTGCTCTGGAACGAGAA
GTGGCAATGGCGCAAGTGGAACGGACCCAAGCAACTCGAGGACAAGAAAACT
AAGAGCTTGATGATGTTGCC
GACCGACTACGTTCTCGTCACCGACAAGTCCTTCAAGAAATGGACCAAGGCTTATGCTGATGACGAGTCTGTTTTCTTCAAAGATTTCTCTGCAGCCTTC
TCTCGTCTCCTCGAACTAGGTGTCCCCACTACCCAATGGGTCACCCAGACTCCATGGGAACTCAAGACACTTGCGGAGCAAGAAGAGAAGAAATAA

Retrieve as FASTA