Entry information : PUtriCcP02
Entry ID 10787
Creation 2012-03-20 (Christophe Dunand)
Last sequence changes 2012-03-20 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-21 (Christophe Dunand)
Peroxidase information: PUtriCcP02
Name PUtriCcP02
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Pucciniaceae Puccinia
Organism Puccinia triticina    [TaxId: 208348 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PUtriCcP02
start..stop
S start..stop
PgrCcP02 707 0 3..388 2..387
CqueCcP02 546 0 48..384 43..372
MlpCcP02 546 0 72..383 62..375
HrufCcP01 429 2e-150 6..384 8..369
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18174..18656 483 N° 2 18721..19005 285 N° 3 19076..19329 254 N° 4 19412..19559 148
join(18174..18656,18721..19005,19076..19329,19412..19559)


exon

Literature and cross-references PUtriCcP02
DNA ref. GenBank:   ADAS01001269.1 (18174..19559)
Protein sequence: PUtriCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   389
PWM (Da):   %s   42615.24  
PI (pH):   %s   8.66
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSVRSANLLRTSAKQFLPTSLVPRARPSAFRSSFYSTPSAGTAQSSSAPPPPPPPHAESKSSKAPLIAGLALGGVGLAYYFYALDSDSDVQKRYTTPKSANSNLNFQAVYNDIAAILEDSNYDDGSYAPVLVRLAWHASGTYDKESKTGGSNGASMRFAPESNHGANAGLGVAREKLEPIYKKYARSGLTYSDLWTLAGVAAIQEIGGPKIPWRPGRQDGVGPESCPPDGRLPDGDKDQDHVRKIFFRMGFNDQEIVALLGAHALGRCHTDRSGFEGPWTFSPTTFSNDYYRLLFDEKWQPRKWSGPPQYEDKKTKSLMMLTTDMCIVMDKSFRNWAKKYATDEKVFFDDFSKAFSKLIELGVPEENFAGKAPMTLKTLDEQGIQIA

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCCGTCCGATCGGCCAACCTCCTGCGCACCTCGGCCAAGCAGTTCCTGCCCACCAGTCTCGTCCCACGGGCCCGTCCGAGTGCCTTCCGATCATCGTTCTACTCCACCCCG
TCCGCCGGGACGGCCCAGTCGTCCTCCGCGCCGCCGCCGCCGCCGCCGCCGCATGCGGAGTCCAAGTCGTCCAAGGCCCCCTTGATCGCCGGGCTCGCCCTCGGTGGTGTCGGCTTGGCC
TACTACTTCTACGCCCTCGACTCCGACTCTGATGTCCAGAAGAGATACACTACCCCCAAATCCGCTAACAGTAACCTCAACTTCCAGGCGGTTTATAACGATATCGCCGCGATCTTGGAG
GACAGTAACTACGACGATGGGTCCTACGCTCCCGTCCTCGTACGTCTCGCCTGGCACGCCTCTGGGACTTACGACAAGGAATCCAAGACCGGTGGCAGTAACGGGGCCTCGATGCGCTTT
GCA
GTCAGTAACACATGCACATATTTCCAAACCGATCGGGCTGATGTTTTTTTTTTTTGGATGTTAGCCCGAAAGTAACCACGGCGCGAACGCGGGTCTGGGTGTAGCCCGGGAAAAGCT
CGAGCCGATCTACAAGAAGTACGCCCGCTCGGGGCTGACGTATTCCGACCTCTGGACGCTTGCCGGGGTGGCTGCGATCCAGGAGATTGGTGGGCCCAAGATCCCGTGGCGTCCGGGCCG
CCAGGACGGAGTTGGGCCAGAGAGCTGTCCCCCGGATGGCCGGCTCCCCGATGGCGACAAGGACCAAGACCACGTGCGAAAAATCTTCTTCCGCATGGGCTTTAACGACCAG
GTCAGTCT
CTTTCTTCTCCCCCCTCATCTGGCTCCTACCGTCCTCATATTGACACTCGCGTTGGCCTCAGGAAATCGTCGCCCTTCTCGGCGCCCACGCCCTCGGTAGATGCCACACCGATCGCTCAG
GCTTCGAAGGCCCTTGGACTTTCTCCCCTACCACCTTCTCTAACGACTACTACCGTCTACTCTTCGACGAGAAGTGGCAGCCTCGCAAGTGGTCCGGTCCGCCTCAATACGAGGACAAGA
AGACCAAGAGTCTGATGATGTTGACGACGGATATGTGTATTGTCATGGACAAGAGCTTCCGCAACTGGGCTAAAAA
GTGCGTCCCCTTCCCCCAAACCAAGAAACACACACTCTCTTTCC
TTTCTAACATCAGGCTGTATCTTCTGTGGTTTTGTTAGGTATGCGACCGACGAAAAAGTGTTCTTTGACGACTTCTCTAAAGCTTTTTCTAAGCTCATCGAACTCGGCGTCCCGGAAGAA
AACTTTGCTGGGAAAGCGCCAATGACCTTGAAAACTTTGGATGAACAAGGCATCCAAATCGCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCCGTCCGATCGGCCAACCTCCTGCGCACCTCGGCCAAGCAGTTCCTGCCCACCAGTCTCGTCCCACGGGCCCGTCCGAGTGCCTTCCGATCATCGTTCTACTCCACCCCG
TCCGCCGGGACGGCCCAGTCGTCCTCCGCGCCGCCGCCGCCGCCGCCGCCGCATGCGGAGTCCAAGTCGTCCAAGGCCCCCTTGATCGCCGGGCTCGCCCTCGGTGGTGTCGGCTTGGCC
TACTACTTCTACGCCCTCGACTCCGACTCTGATGTCCAGAAGAGATACACTACCCCCAAATCCGCTAACAGTAACCTCAACTTCCAGGCGGTTTATAACGATATCGCCGCGATCTTGGAG
GACAGTAACTACGACGATGGGTCCTACGCTCCCGTCCTCGTACGTCTCGCCTGGCACGCCTCTGGGACTTACGACAAGGAATCCAAGACCGGTGGCAGTAACGGGGCCTCGATGCGCTTT
GCA
CCCGAAAGTAACCACGGCGCGAACGCGGGTCTGGGTGTAGCCCGGGAAAAGCTCGAGCCGATCTACAAGAAGTACGCCCGCTCGGGGCTGACGTATTCCGACCTCTGGACGCTTGCC
GGGGTGGCTGCGATCCAGGAGATTGGTGGGCCCAAGATCCCGTGGCGTCCGGGCCGCCAGGACGGAGTTGGGCCAGAGAGCTGTCCCCCGGATGGCCGGCTCCCCGATGGCGACAAGGAC
CAAGACCACGTGCGAAAAATCTTCTTCCGCATGGGCTTTAACGACCAG
GAAATCGTCGCCCTTCTCGGCGCCCACGCCCTCGGTAGATGCCACACCGATCGCTCAGGCTTCGAAGGCCCT
TGGACTTTCTCCCCTACCACCTTCTCTAACGACTACTACCGTCTACTCTTCGACGAGAAGTGGCAGCCTCGCAAGTGGTCCGGTCCGCCTCAATACGAGGACAAGAAGACCAAGAGTCTG
ATGATGTTGACGACGGATATGTGTATTGTCATGGACAAGAGCTTCCGCAACTGGGCTAAAAA
GTATGCGACCGACGAAAAAGTGTTCTTTGACGACTTCTCTAAAGCTTTTTCTAAGCTC
ATCGAACTCGGCGTCCCGGAAGAAAACTTTGCTGGGAAAGCGCCAATGACCTTGAAAACTTTGGATGAACAAGGCATCCAAATCGCGTAG

Retrieve as FASTA