Entry information : MosmCcP01
Entry ID 10788
Creation 2012-03-20 (Christophe Dunand)
Last sequence changes 2012-03-20 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-05-28 (Christophe Dunand)
Peroxidase information: MosmCcP01
Name MosmCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Mixiaceae Mixia
Organism Mixia osmundae    [TaxId: 34349 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MosmCcP01
start..stop
S start..stop
MvioCcP02 416 6e-146 106..378 66..338
MlpCcP02 416 1e-145 67..380 63..374
RgraCcP02 413 1e-144 107..377 83..353
CqueCcP02 413 2e-144 19..380 14..370
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 508802..509074 273 N° 2 508617..508745 129 N° 3 508472..508566 95 N° 4 508285..508411 127
N° 5 508084..508227 144 N° 6 507891..508033 143 N° 7 507769..507834 66 N° 8 507553..507721 169
complement(join(507553..507721,507769..507834,507891..508033,508084..508227,5082 85..508411,508472..508566,508617..508745,508802..509074))


exon

Literature and cross-references MosmCcP01
DNA ref. JGI genome:   scaffold_5 (509074..507553)
Cluster/Prediction ref. JGI gene:   103348
Protein sequence: MosmCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   381
PWM (Da):   %s   41397.49  
PI (pH):   %s   7.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASVMSSRMATPALRQIGQAASRRTIIQLATRQTARALPTYQRRSASTGSGPSSSSSSKTAIYAVGGLAGIGAAVWFFGLTDTKKAELEDDATGGHARARGMLGGVVDYQKVYNEIANVLEAEHYDDGSYGPVLIRLAWHCSGTYDKNSGNGGSNGATMRFAPESNHGANAGLLAARELLEPIHAKFPEMSYSDLWTLAGVVAVMQLGPTIPWRPGRVDADASQCTPDGRLPDGDKDQDHLRQIFYRMGFDDEGIVALSGAHAVGRCHPDRSGFSGPWQHSPTSFNNEYYKLLFNEKWQLKKWDGPIQYEDKSTKSLMMLTTDMALTKDKAFKPIAKRFADDEGLFFTSFSKYFAQLLELGVPAKNFEGREPITFTPADV

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCGTGATGAGCAGCAGAATGGCCACGCCTGCGTTACGACAGATCGGACAGGCAGCATCCAGGCGTACGATTATCCAGCTGGCGACCCGTCAGACAGCCAGAGCTCTACCGACT
TATCAACGACGATCGGCTTCAACTGGCTCTGGACCATCATCGTCGAGCTCCTCAAAGACCGCAATCTATGCAGTCGGAGGCTTGGCTGGTATCGGTGCAGCTGTCTGGTTTTTCGGCTTG
ACAGACACGAAAAAGGCCGAATTAGAGGATGAT
GCAAGTCGCCGCACCTTTATCAGCGTCAACATTCTAATGTCACGCCTTTCATACAGGCTACTGGCGGACATGCTCGTGCTAGAGGTA
TGCTGGGTGGTGTAGTAGACTACCAGAAGGTGTACAACGAGATCGCCAATGTGCTCGAAGCAGAGCACTATGACGACGGTTCCTATGGCCCTGTCCTA
GTACGCCGCTCGATCGCGCCCG
TAGTAAGCTCGGCTGATGATGTGTGCAGATCCGTTTGGCGTGGCACTGCAGTGGCACGTATGACAAGAACAGTGGCAACGGCGGCAGCAACGGCGCCACCATGCGATTTGCTCCCGAGTC
AAA
GTCAGCTCAGTGCACGTCTGCGTGATCTCAGAAGCTGACCTTGCATATCTTCATTCGCAGTCATGGCGCCAATGCAGGTCTCCTGGCTGCGCGAGAGCTGCTTGAACCCATCCACGC
CAAATTCCCAGAAATGAGCTATTCGGATCTCTGGACGCTTGCCGGCGTCGTTGCCGTCATGCAGCTAGGC
GTAAGTGCAGCGGTAGCACATTCTGCACGTTTGACAGAGCTTACCATGAT
ACTGCAGGGCCCGACGATCCCTTGGCGTCCGGGACGCGTCGATGCAGATGCATCGCAATGCACACCCGATGGGCGTTTGCCCGATGGCGACAAGGACCAGGATCACCTCAGGCAGATCTT
CTACCGCATGGGCTTCGATGACGAGGGCATT
GTGCGTCTCGCTTCTACGTGAGCCGCCACAAGAGGCTAATATGAGGCTAGGTCGCATTGTCGGGCGCACACGCTGTAGGACGATGCCAC
CCAGACCGATCTGGTTTCTCCGGACCATGGCAACACTCGCCTACGAGTTTCAACAACGAGTACTACAAGCTACTTTTCAACGAGAAATGGCAGCTCAAGAAGTG
GTATGTCGCACTTCGT
TCCACTGGCTCGAAGTTCCGCTGACATATCGTCCATCCAGGGACGGTCCGATCCAGTACGAGGACAAGTCTACCAAATCGTTGATGATGCTCACGACCGATATGGCGTAAGTCTGCTCAG
CTATGATGAGATCAAAGCTGACATCATTTGTAGCTTGACAAAAGACAAGGCATTCAAGCCGATCGCCAAGCGCTTCGCAGACGACGAGGGGCTATTCTTTACTAGCTTCTCAAAGTACTT
TGCCCAGCTGCTCGAACTCGGCGTTCCGGCCAAGAACTTTGAAGGACGAGAGCCCATCACATTCACGCCCGCAGATGTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCGTGATGAGCAGCAGAATGGCCACGCCTGCGTTACGACAGATCGGACAGGCAGCATCCAGGCGTACGATTATCCAGCTGGCGACCCGTCAGACAGCCAGAGCTCTACCGACT
TATCAACGACGATCGGCTTCAACTGGCTCTGGACCATCATCGTCGAGCTCCTCAAAGACCGCAATCTATGCAGTCGGAGGCTTGGCTGGTATCGGTGCAGCTGTCTGGTTTTTCGGCTTG
ACAGACACGAAAAAGGCCGAATTAGAGGATGAT
GCTACTGGCGGACATGCTCGTGCTAGAGGTATGCTGGGTGGTGTAGTAGACTACCAGAAGGTGTACAACGAGATCGCCAATGTGCTC
GAAGCAGAGCACTATGACGACGGTTCCTATGGCCCTGTCCTA
ATCCGTTTGGCGTGGCACTGCAGTGGCACGTATGACAAGAACAGTGGCAACGGCGGCAGCAACGGCGCCACCATGCGA
TTTGCTCCCGAGTCAAA
TCATGGCGCCAATGCAGGTCTCCTGGCTGCGCGAGAGCTGCTTGAACCCATCCACGCCAAATTCCCAGAAATGAGCTATTCGGATCTCTGGACGCTTGCCGGC
GTCGTTGCCGTCATGCAGCTAGGC
GGCCCGACGATCCCTTGGCGTCCGGGACGCGTCGATGCAGATGCATCGCAATGCACACCCGATGGGCGTTTGCCCGATGGCGACAAGGACCAGGAT
CACCTCAGGCAGATCTTCTACCGCATGGGCTTCGATGACGAGGGCATT
GTCGCATTGTCGGGCGCACACGCTGTAGGACGATGCCACCCAGACCGATCTGGTTTCTCCGGACCATGGCAA
CACTCGCCTACGAGTTTCAACAACGAGTACTACAAGCTACTTTTCAACGAGAAATGGCAGCTCAAGAAGTG
GGACGGTCCGATCCAGTACGAGGACAAGTCTACCAAATCGTTGATGATG
CTCACGACCGATATGGC
CTTGACAAAAGACAAGGCATTCAAGCCGATCGCCAAGCGCTTCGCAGACGACGAGGGGCTATTCTTTACTAGCTTCTCAAAGTACTTTGCCCAGCTGCTCGAA
CTCGGCGTTCCGGCCAAGAACTTTGAAGGACGAGAGCCCATCACATTCACGCCCGCAGATGTTTAG

Retrieve as FASTA