Entry information : MosmCcP02
Entry ID 10789
Creation 2012-03-20 (Christophe Dunand)
Last sequence changes 2012-03-20 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-05-28 (Christophe Dunand)
Peroxidase information: MosmCcP02
Name MosmCcP02
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Basidiomycota Mixiaceae Mixia
Organism Mixia osmundae    [TaxId: 34349 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MosmCcP02
start..stop
S start..stop
CqueCcP01 418 2e-148 2..293 3..302
UhorCcP01 418 2e-148 1..290 1..309
UmCcP01 415 4e-147 1..291 1..310
SreCcP01 414 7e-147 1..299 1..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 283544..283686 143 N° 2 283459..283489 31 N° 3 283310..283406 97 N° 4 283088..283259 172
N° 5 282708..283036 329 N° 6 282510..282655 146  
complement(join(282510..282655,282708..283036,283088..283259,283310..283406,2834 59..283489,283544..283686))


exon

Literature and cross-references MosmCcP02
DNA ref. JGI genome:   scaffold_4 (283686..282510)
Cluster/Prediction ref. JGI gene:   60670
Protein sequence: MosmCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   306
PWM (Da):   %s   33651.44  
PI (pH):   %s   5.45
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSKEVDYDAVRKDIAACMEQPGYDDGSAGPVFVRLAWHSAGTYCKDTKTGGSNGAGMYEKEGGDPANAGLQHARVFLEPVKAKHENLSYADLWTLAGVVAIEEMGGPKIEWKAGRTDFTDDSKVPPRGRLPDGAQAEDHLRAVFGRMGFTDDEIITLSGAHNLGRCHADRSGFEGPWVMRPTVFSNQYYKMLKNMEWKPKEWSGPKQYANDDLGQELMMLETDLALLKMNKDLVHKYADDKDAFFDDFAKVFAKLELGVDRKDAGYEAAPKKSNDAGAPGQEGNDGQASIVKHDDVKKTRSSK

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAAAGGAAGTAGACTACGACGCAGTCCGCAAGGACATTGCTGCATGCATGGAGCAGCCGGGCTATGACGATGGCTCGGCGGGACCTGTGTTCGTGCGATTAGCGTGGCATAGCGCC
GGCACGTATTGCAAAGACACCAA
GTCAGTGATAGCCCACCAGCTCGTCAGAACATGACTCATAGGACACATTCTCAGGACCGGCGGTAGCAACGGTGCAGGCATGAGGGTCAGCCGGTCG
GCGACACGCTGTCATTTAGCTGCTAACATGCAATTGACAGTATGAGAAAGAGGGCGGCGATCCTGCCAACGCCGGCTTGCAACATGCCCGTGTCTTCCTCGAGCCCGTCAAGGCGAAGCA
CGAGAACCTCTCGTATG
GTGAGCTGCCCTCTCGCTGTTTCGAGAACGAGCTAATTCCTGGCCGATAGCTGATCTCTGGACACTCGCCGGTGTGGTGGCAATAGAAGAGATGGGCGGCCCC
AAGATCGAGTGGAAGGCCGGTAGAACAGACTTCACAGACGACAGCAAAGTACCTCCTCGAGGTCGTCTGCCCGATGGCGCACAAGCCGAAGACCACCTGCGAGCCGTCTTTGGCCGAAT
G
TAAGTACAGCCTTGCCAGCGCGTCCGTGGCGCGCTAAAACGGTCTTGTAGGGGCTTTACTGACGACGAGATCATCACGCTCTCTGGCGCACACAATCTCGGTCGCTGTCACGCTGATCGC
TCCGGCTTCGAAGGCCCTTGGGTCATGCGACCGACCGTGTTCTCGAACCAATATTACAAGATGCTCAAGAATATGGAATGGAAGCCAAAGGAGTGGTCCGGACCCAAGCAATATGCCAAC
GATGACCTCGGCCAGGAGCTCATGATGCTCGAGACCGATCTTGCGTTGCTCAAGATGAACAAGGATCTCGTGCACAAGTATGCAGACGACAAGGACGCTTTCTTCGACGACTTTGCCAAG
GTCTTTGCTAAGCTTATTG
GTCAGCACTCTTCTGCAGCGTTCACAAATGCCCGAAGCTCATCGTATTGCAGAACTCGGCGTTGATCGCAAGGATGCTGGCTATGAAGCGGCCCCCAAGAA
GTCAAACGATGCTGGCGCACCTGGTCAAGAAGGCAACGATGGACAAGCCTCGATTGTCAAACACGATGATGTCAAGAAGACGAGATCGTCCAAGCTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAAAGGAAGTAGACTACGACGCAGTCCGCAAGGACATTGCTGCATGCATGGAGCAGCCGGGCTATGACGATGGCTCGGCGGGACCTGTGTTCGTGCGATTAGCGTGGCATAGCGCC
GGCACGTATTGCAAAGACACCAA
GACCGGCGGTAGCAACGGTGCAGGCATGAGGTATGAGAAAGAGGGCGGCGATCCTGCCAACGCCGGCTTGCAACATGCCCGTGTCTTCCTCGAGCCC
GTCAAGGCGAAGCACGAGAACCTCTCGTATG
CTGATCTCTGGACACTCGCCGGTGTGGTGGCAATAGAAGAGATGGGCGGCCCCAAGATCGAGTGGAAGGCCGGTAGAACAGACTTCACA
GACGACAGCAAAGTACCTCCTCGAGGTCGTCTGCCCGATGGCGCACAAGCCGAAGACCACCTGCGAGCCGTCTTTGGCCGAAT
GGGCTTTACTGACGACGAGATCATCACGCTCTCTGGC
GCACACAATCTCGGTCGCTGTCACGCTGATCGCTCCGGCTTCGAAGGCCCTTGGGTCATGCGACCGACCGTGTTCTCGAACCAATATTACAAGATGCTCAAGAATATGGAATGGAAGCCA
AAGGAGTGGTCCGGACCCAAGCAATATGCCAACGATGACCTCGGCCAGGAGCTCATGATGCTCGAGACCGATCTTGCGTTGCTCAAGATGAACAAGGATCTCGTGCACAAGTATGCAGAC
GACAAGGACGCTTTCTTCGACGACTTTGCCAAGGTCTTTGCTAAGCTTATTG
AACTCGGCGTTGATCGCAAGGATGCTGGCTATGAAGCGGCCCCCAAGAAGTCAAACGATGCTGGCGCA
CCTGGTCAAGAAGGCAACGATGGACAAGCCTCGATTGTCAAACACGATGATGTCAAGAAGACGAGATCGTCCAAGCTA

Retrieve as FASTA