Entry information : GrPrx02 ( Gorai.005G126200 [2.1])
Entry ID 10790
Creation 2012-03-21 (Qiang Li)
Last sequence changes 2016-03-08 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-03-08 (Achraf Jemmat)
Peroxidase information: GrPrx02 ( Gorai.005G126200 [2.1])
Name (synonym) GrPrx02 ( Gorai.005G126200 [2.1])
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Malvaceae Gossypium
Organism Gossypium raimondii    [TaxId: 29730 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GrPrx02
start..stop
S start..stop
PpePrx77 529 0 1..339 2..343
TsPrx61 520 0 3..337 2..336
QrobPrx02 516 0 25..338 23..336
BrPrx61-1Aa_other 512 0 10..337 11..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 53..304 252 N° 2 803..982 180 N° 3 1073..1232 160 N° 4 1590..2017 428
join(53..304,803..982,1073..1232,1590..2017)


exon

Literature and cross-references GrPrx02 ( Gorai.005G126200 [2.1])
Cluster/Prediction ref. Genebank:   105793994
Protein sequence: GrPrx02 ( Gorai.005G126200 [2.1])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (312)
PWM (Da):   %s   37798.95 (34776.4)  
PI (pH):   %s   7.93 (7.98) Peptide Signal:   %s   cut: 28 range:28-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRRERLGFGFALAVLSLWCSMEVAVEAAWSLQTPVNLVWHYYKVHNTCDNAEAYIRHQVESFYKYDKTIAPKLLRLLYADCFVNGCDASVLLDGPNSEKTAPQNRGLAGFAFIDKIKTVLEARCPGVVSCADILNLATRDAVHLAGAPSYPVYTGRRDGMTSTKDSVDLPSPSISWEASLTYFRSRGLDVLDMTTLLGAHSMGRTHCSFIVDRLYNFNDTGKPDPSMKASLLEEMRKLCPPKTKKGQPDPLIFLNPASGSKYSFINSYYSRVLTNEAVLGVDQQLLYNEDTKQITEEFAAGFEDFRRSFALSMSRMGNINVLTGKEGEIRKNCRFPNKK

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 3 introns). Containing Motif 'YADC'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGAGAGAAAGGTTGGGTTTCGGTTTTGCTCTTGCAGTACTGAGCTTGTGGTGCTCAATGGAGGTTGCGGTTGAGGCGGCATGGTCATTGCAGACTCCGGTGAACCTGGTTTGGCAT
TACTATAAGGTGCATAATACATGTGATAATGCAGAGGCTTATATTAGGCACCAAGTGGAATCGTTTTATAAGTATGATAAAACTATTGCACCTAAGCTTCTTCGCTTGCTGTATGCGGAT
TGTTTTGTAAAT
GTAAGTATTTATCATTGTTTTCCTTTTTCCTTTTTTATTTGTATATTTCATAAGTGTCTGCTGCACCCTTTTCTTTCTAATTATCATAAAGCACACTTTTTTCCCATC
CCGGGGATAAATTTTTATTTTGTTATTTAGAAGAAATTATAATTACGAGTACGTCCTAAATTTAAATAATTATAATCAAAATCATTTATTAAAATGCATCAAACTCACCTACTACAAATA
AAAATAACGGCGGAACTGAAACATGAGAGACTTCACGTTTCCAAAGCCAATTCGGCTTTCCATCTTAGTAATACTATTTATGATGGAATATCACATGAATGATTGTATGAAATATATTAA
AAGTAATTTTCTAGGCTTTACTACTAAGAGGTTTGTCAACTGGAGAGTTCATTTATATGAAAATTTCAGTTGATTGTAATGAAAGGATAAAGATTTGGATGCCAAAGTCTTTTGGTTTTA
ATACTTACAAGGGTTGATGGAAATGGTTAGGGATGCGATGCTTCAGTCCTGCTAGATGGGCCGAATTCGGAGAAGACTGCACCACAGAACAGGGGACTGGCAGGGTTCGCGTTCATCGAC
AAGATTAAGACGGTGCTTGAAGCTCGTTGCCCAGGCGTTGTCTCTTGTGCTGACATTCTTAACCTCGCCACTCGAGATGCTGTTCATTTG
GTATGTATTTATTTAATTTTTCTCATCATT
AAATAAATCTCTAGAGTATTTGTATCATATAAATCATTAATTCATATTATATAAATTCAGGCAGGAGCACCGTCTTATCCCGTATATACAGGGAGAAGAGACGGGATGACATCGACCAAG
GACTCCGTTGATCTCCCTTCACCATCCATCTCCTGGGAAGCTTCTCTCACTTATTTCCGATCAAGAGGCTTGGATGTGTTGGACATGACAACCCTATTAG
GTAAAACACTAACACGGATA
CATCAACTAGTCAAAATCTATATCTATTATTAACCTGTTAGTGTATACAAACATGTGGAATTAACATGAACAAGGTATGATTAAAAGCTATAGGGTGGGAGTGGAACAGAATGAATACTA
CTAATCACTTTTTTTTTCCCACTTCATTGGCAAATAGAGGAATAAACAAACCATCAGTAATATGAACCTGGTATTTAGCTCAGTTGGTTCACACAACTAACCTTAAAAAGCGACTTCTAG
CAGAACCGGCATTCGAACCCCAACATCTGCAACTCCCTCCCCTATCCTTAGACTATGGATCCCTTTTTAATGATAATTTCTTGGCACTTCTTATCAGGAGCACATTCCATGGGGAGAACA
CACTGCAGCTTCATTGTGGATAGGCTGTACAATTTCAATGATACAGGAAAGCCAGATCCAAGCATGAAGGCGTCATTGTTGGAAGAAATGAGGAAGCTATGTCCGCCAAAAACTAAAAAG
GGCCAACCCGACCCGCTCATATTTCTAAACCCAGCATCCGGATCCAAATATAGTTTCATCAACTCCTACTACTCCAGAGTGTTAACCAATGAAGCTGTCCTTGGAGTTGATCAGCAGCTA
CTCTATAACGAAGATACTAAGCAAATCACTGAAGAATTCGCTGCCGGGTTTGAAGATTTCAGGAGATCATTTGCTCTTTCCATGAGTCGAATGGGAAATATCAATGTTCTAACAGGTAAG
GAAGGTGAAATACGCAAAAATTGCAGATTTCCAAACAAAAAATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGAGAGAAAGGTTGGGTTTCGGTTTTGCTCTTGCAGTACTGAGCTTGTGGTGCTCAATGGAGGTTGCGGTTGAGGCGGCATGGTCATTGCAGACTCCGGTGAACCTGGTTTGGCAT
TACTATAAGGTGCATAATACATGTGATAATGCAGAGGCTTATATTAGGCACCAAGTGGAATCGTTTTATAAGTATGATAAAACTATTGCACCTAAGCTTCTTCGCTTGCTGTATGCGGAT
TGTTTTGTAAAT
GGATGCGATGCTTCAGTCCTGCTAGATGGGCCGAATTCGGAGAAGACTGCACCACAGAACAGGGGACTGGCAGGGTTCGCGTTCATCGACAAGATTAAGACGGTGCTT
GAAGCTCGTTGCCCAGGCGTTGTCTCTTGTGCTGACATTCTTAACCTCGCCACTCGAGATGCTGTTCATTTG
GCAGGAGCACCGTCTTATCCCGTATATACAGGGAGAAGAGACGGGATG
ACATCGACCAAGGACTCCGTTGATCTCCCTTCACCATCCATCTCCTGGGAAGCTTCTCTCACTTATTTCCGATCAAGAGGCTTGGATGTGTTGGACATGACAACCCTATTAG
GAGCACAT
TCCATGGGGAGAACACACTGCAGCTTCATTGTGGATAGGCTGTACAATTTCAATGATACAGGAAAGCCAGATCCAAGCATGAAGGCGTCATTGTTGGAAGAAATGAGGAAGCTATGTCCG
CCAAAAACTAAAAAGGGCCAACCCGACCCGCTCATATTTCTAAACCCAGCATCCGGATCCAAATATAGTTTCATCAACTCCTACTACTCCAGAGTGTTAACCAATGAAGCTGTCCTTGGA
GTTGATCAGCAGCTACTCTATAACGAAGATACTAAGCAAATCACTGAAGAATTCGCTGCCGGGTTTGAAGATTTCAGGAGATCATTTGCTCTTTCCATGAGTCGAATGGGAAATATCAAT
GTTCTAACAGGTAAGGAAGGTGAAATACGCAAAAATTGCAGATTTCCAAACAAAAAATAG

Retrieve as FASTA