Entry information : ApraCIIBC01 (mnp1)
Entry ID 10800
Creation 2012-04-03 (Christophe Dunand)
Last sequence changes 2012-04-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Christophe Dunand)
Peroxidase information: ApraCIIBC01 (mnp1)
Name (synonym) ApraCIIBC01 (mnp1)
Class Other class II peroxidase type C    [Orthogroup: CIIBC001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Bolbitiaceae Agrocybe
Organism Agrocybe praecox    [TaxId: 71668 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ApraCIIBC01
start..stop
S start..stop
GmarCIIBC 596 0 1..355 1..354
GmarCIIBC12 578 0 1..355 1..354
GmarCIIBC09 574 0 1..358 1..359
GmarCIIBC07 565 0 1..358 1..360
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..124 124 N° 2 187..306 120 N° 3 358..420 63 N° 4 484..562 79
N° 5 623..839 217 N° 6 894..1116 223 N° 7 1170..1264 95 N° 8 1317..1459 143
N° 9 1514..1526 13  
join(1..124,187..306,358..420,484..562,623..839,894..1116,1170..1264,1317..1459, 1514..1526)


exon

Literature and cross-references ApraCIIBC01 (mnp1)
Literature Hilden,K., Lundell,T.K., Steffen,K.T., Hofrichter,M., Archer,D.B. and Hatakka,A. Molecular characterization of two class II peroxidases of the litter-decomposing basidiomycete Agrocybe praecox and the irexpression on lignocellulose
DNA ref. GenBank:   HQ336221.1
Protein sequence: ApraCIIBC01 (mnp1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (337)
PWM (Da):   %s   37477.99 (35359.9)  
PI (pH):   %s   4.87 (4.76) Peptide Signal:   %s   cut: 22 range:22-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFTRLSAILSVALAATQVCAVPAKRVTCKTGQVTANAACCALFPVVELMQDQLFDGSECGEEAHSALRLSFHDAIGFSLRGGKGGGADGSILAFNKTENAFHANGGIDDITDGQFPIFLQSGLSAGDFVHLAAAVGTSNCPGAPRLEFMFGRPPPKAPAPDLTVPEPTDTVTKILERFADAGFSPPEAVALLSSHTIAADVVDVTIPGTPFDSTVGTFDTQVFLEVLLKGKLFPGNGSQPGEVLSPLAGEMRLQSDFRISQDPRTACFWQAMVNNQELMIAEFRAAMSKLQVLGQDKSRLIDCSVVPVPKSFTGNIKFPATFSRKDVQIACPLLPFPNLATVAGPAPTIPPVPGS

Retrieve as FASTA  
Remarks Complete sequence from genomic
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTACTCGTCTCTCAGCTATCCTTTCCGTCGCTCTTGCAGCCACCCAGGTGTGTGCTGTTCCAGCCAAACGCGTCACTTGCAAGACTGGCCAGGTTACAGCAAACGCCGCCTGC
TGTG
GTCAGTAATTATCCTCTTTTGATGTTGACGAAGTCCTGTGTTTATTGATTAATTTGCCTCAGCGTTATTCCCCGTTGTCGAGCTCATGCAAGACCAGCTCTTTGACGGCTCTGAAT
GTGGGGAAGAAGCTCACTCAGCTCTTCGTCTGTCGTTCCATGACGCAATTGGTTTCTCTCTCCGTG
GTAAGGGAACCTTACATTCATTACGGGGCAGGATTTAATTAACTCGCACAGGTG
GAAAGGGAGGAGGAGCCGATGGTTCCATTCTGGCTTTCAACAAGACCGAGAACGCATTCC
GTAAGTTTTAGAATACAATTGAACAATAATCTTTGTTTACCTTTTTTTTTTAAAAAAAAA
TAGATGCTAACGGCGGCATCGATGATATTACTGATGGTCAATTCCCTATTTTCCTTCAATCTGGCCTGAGCGCTGGTGATTTGTAAGTCTTTGTTCCATGGAAAACTACTTCACGTCCTT
CACTCTGACGCCAAATCCAAAGTGTTCACCTCGCCGCGGCGGTCGGAACATCTAACTGCCCAGGTGCACCCAGACTCGAATTTATGTTCGGTCGCCCGCCCCCAAAGGCACCCGCCCCCG
ACCTGACTGTTCCAGAACCCACCGACACCGTCACCAAAATTCTCGAGAGATTTGCTGATGCCGGTTTTTCCCCACCTGAAGCAGTCGCGCTCCTCTCGTCTCACACAATCGCTGCAGCC
G
TACGTATACATTCTATTTTGAAAAACAATATACCAATCTAACGGAAAATGTAGGATGTTGTTGACGTGACTATTCCAGGAACGCCATTCGACTCTACTGTTGGTACATTCGATACCCAAG
TCTTCCTTGAAGTCTTGCTCAAGGGTAAACTTTTCCCTGGAAACGGATCTCAACCTGGAGAAGTTCTCTCTCCTCTAGCTGGAGAAATGCGTCTCCAATCCGACTTCAGAATCTCTCAGG
ACCCAAGGACAGCTTGCTTCTGGCAGGCCATGGTCA
GTGAGTACCGAATCAACTATTTCGCCTTAATACACGCTAATGGTAATCCAAAGACAATCAGGAGCTCATGATAGCTGAGTTCAG
AGCCGCCATGTCTAAGCTTCAAGTTCTCGGCCAAGACAAGAGCCGTCTCATTGATTGCTCTGAT
GTACGTACAATATCTCATTCTTTCGGTGTTCTTTTCCTGACATAGGTTATAGGTTG
TTCCCGTTCCTAAGTCATTCACCGGAAACATCAAGTTCCCTGCAACCTTCTCCCGCAAGGATGTCCAAATCGCTTGTCCCTTGCTCCCATTCCCCAACCTCGCCACTGTTGCAGGTCCCG
CGCCCACCATCCCGCCTGT
GTAAGTGCCCAATACGTCAGTTAGACCGTCATTTTTCTAACAATATTAACTCAGTCCCGGATCTTGA

Retrieve as FASTA