Entry information : TcinCIIBB01_DSH97 (mnp1)
Entry ID 10802
Creation 2012-04-03 (Christophe Dunand)
Last sequence changes 2012-04-04 (Christophe Dunand)
Sequence status partial
Reviewer Nizar Fawal
Last annotation changes 2013-10-16 (Nizar Fawal)
Peroxidase information: TcinCIIBB01_DSH97 (mnp1)
Name (synonym) TcinCIIBB01_DSH97 (mnp1)
Class Other class II peroxidase type B     [Orthogroup: CIIBB001]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Pycnoporus
Organism Trametes cinnabarina (Pycnoporus cinnabarinus)    [TaxId: 5643 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TcinCIIBB01_DSH97
start..stop
S start..stop
TvCIIBB02_IFO30340 341 4e-119 1..201 75..275
TvCIIBB02 340 5e-119 1..201 75..275
TvCIIBB02_PRL572 340 5e-119 1..201 75..275
TvCIIBB02_KN9522 338 3e-118 1..201 75..275
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..49 49 N° 2 105..239 135 N° 3 296..716 421  
join(1..49,105..239,296..716)


exon

Literature and cross-references TcinCIIBB01_DSH97 (mnp1)
Literature Morgenstern,I., Robertson,D.L. and Hibbett,D.S. Characterization of 3 mnp genes in Fomitiporia mediterranea and report of additional class II peroxidases in the Hymenochaetales
DNA ref. GenBank:   HM480290.1 [Fragment]
Protein sequence: TcinCIIBB01_DSH97 (mnp1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   201
PWM (Da):   %s   21038.34  
PI (pH):   %s   3.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTLSVSRSLPLLVANSAAVALTARSPSSKTSRRTSTRTWVLTRSLMSRSPSYSAATSARPTSSNLRALLVSATALVLLSWMSSSAAPMRLSLPPT*PFRSPSTPSTAFSLALPTPVTLLPRRSSPSWSATLSLPLITSTRRFRAPLSTPLRSCSTPSSSSRRSSVVRCSRAPVATRARSSPLSRASSVSSPTRSLPVTLAX

Retrieve as FASTA  
Remarks Partial sequence from genomic (5' and 3' end are missing). strain="DSH 97-310"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACGACGCTATCGGTATCTCGCAGTCTGCCACTTCTCGTGGCCAATTCGGGTGAGTTGTAGACTTGTCTTGGGTGTCGCCAATACCAACTGACACCACTCTGTAGCGGCGGTGGCGCTGAC
GGCTCGATCGCCATCTTCGAAGACATCGAGACGAACTTCCACGCGAACCTGGGTGTTGACGAGATCATTGATGAGCAGAAGCCCTTCGTACAGCGCAGCAACATCAGCACGGCCGACTT
G
TGAGTTTGTTATCTCACGTCATGAATCGTTAGTAACTGACATGGTCCCTATGCAGCATCCAATTTGCGGGCGCTATTGGTGTCAGCAACTGCCCTGGTGCTCCTCAGTTGGATGTCTTCC
TCGGCCGCGCCGATGCGACTCAGCCTGCCCCCGACTTAACCGTTCCGGAGCCCTTCGACACCGTCGACAGCATTCTCGCTCGCTTTGCCGACGCCGGTAACTTTACTCCCGAGGAGGTCG
TCGCCCTCCTGGTCAGCCACACTATCGCTGCCGCTGATCACGTCGACCCGACGATTCCGGGCACCCCTTTCGACTCCACTCCGGAGCTGTTCGACACCCAGTTCTTCATCGAGACGCAGC
TCCGTGGTACGCTGTTCCCGGGCACCGGTGGCAACCAGGGCGAGGTCGAGTCCCCTCTCGCGGGCGAGCTCCGTCTCCAGTCCGACTCGGAGCTTGCCCGTGACTCTCGCACTGCT

Retrieve as FASTA