Entry information : TcinCIIBB02_DSH97 (mnp2)
Entry ID 10804
Creation 2012-04-04 (Christophe Dunand)
Last sequence changes 2012-04-04 (Christophe Dunand)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2012-04-04 (Christophe Dunand)
Peroxidase information: TcinCIIBB02_DSH97 (mnp2)
Name (synonym) TcinCIIBB02_DSH97 (mnp2)
Class Other class II peroxidase type B     [Orthogroup: CIIBB001]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Pycnoporus
Organism Trametes cinnabarina (Pycnoporus cinnabarinus)    [TaxId: 5643 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TcinCIIBB02_DSH97
start..stop
S start..stop
TvCIIBB02_IFO30340 331 3e-115 1..201 75..275
TvCIIBB02 331 3e-115 1..201 75..275
TvCIIBB02_PRL572 331 3e-115 1..201 75..275
TvCIIBB02_KN9522 329 1e-114 1..201 75..275
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..184 184 N° 2 241..441 201 N° 3 494..713 220  
join(1..184,241..441,494..713)


exon

Literature and cross-references TcinCIIBB02_DSH97 (mnp2)
Literature Morgenstern,I., Robertson,D.L. and Hibbett,D.S. Characterization of 3 mnp genes in Fomitiporia mediterranea and report of additional class II peroxidases in the Hymenochaetales
DNA ref. GenBank:   HM480292.1 [Fragment]
Protein sequence: TcinCIIBB02_DSH97 (mnp2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   201
PWM (Da):   %s   21291.7  
PI (pH):   %s   4.11
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTPLASRPRSQPPACSAVEALTVPLPSSRTSRPTSTPTWAWTKSSTSRGLSSNVTTSPSLTLSSLLVPSV*ATALVLPAWTSLLAARTQLSPLPT*PCPSLSIM*PTSWNGLTMPASSLPRRSSPSWSRTPSPPLIMSTPPFPALHSILPQRSSTLSSSLRPCSRVRSSLVPPATRVRSSPPSTARFVSSPTSSSRATPAX

Retrieve as FASTA  
Remarks Partial sequence from genomic (5' and 3' end are missing). strain="DSH 97-310".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACGACGCCATTGGCATCTCGCCCAAGATCGCAGCCACCGGCGTGTTCGGCGGTGGAGGCGCTGACGGTTCCATTGCCATCTTCGAGGACATCGAGACCAACTTCCACGCCAACTTGGGCG
TGGACGAAATCATCGACGAGCAGAGGCCTCTCATCCAACGTCACAACATCTCCGTCGCTGACTT
GTGAGCGGCGAATGGTTTCAACGTTCTGAGGTGCACTAACTGATACTGCGGTGTAG

TATCCAGTTTGCTGGTGCCATCGGTGTGAGCAACTGCCCTGGTGCTCCCCGCTTGGACGTCTTTGTTGGCCGCAAGGACGCAACTCAGCCCGCTCCCGACCTGACCGTGCCCGAGCCTTT
CGATAATGTGACCCACATCCTGGAACGGTTTGACGATGCCGGCAAGTTCACTCCCGCGGAGGTCGTCGCCCTCCTGGTCTC
GTGTGTATCATTTGTTGCTCGCGTACAGCCCTTGTACTG
ACAAACTGTCCAGGCACACCATCGCCGCCGCTGATCATGTCGACCCCACCATTCCCGGCACTCCATTCGATTCTACCCCAGAGGAGTTCGACACTCAGTTCTTCATTGAGACCCTGCTCA
AGGGTACGCTCTTCCCTGGTACCGCCGGCAACCAGGGTGAGGTCGAGTCCCCCCTCCACGGCGAGATTCGTCTCCAGTCCGACTTCGAGCTCGCGCGCGACGCCCGCACCGCC

Retrieve as FASTA