Entry information : PgrDyPrx08
Entry ID 10808
Creation 2012-04-03 (Catherine Mathe (Scipio))
Last sequence changes 2012-04-05 (Catherine Mathe (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-05 (Christophe Dunand)
Peroxidase information: PgrDyPrx08
Name PgrDyPrx08
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Fungi/Metazoa; Fungi; Basidiomycota; Basidiomycota
Organism Puccinia graminis f. sp. tritici    [TaxId: 56615 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PgrDyPrx08
start..stop
S start..stop
PgrDyPrx01 1036 0 1..509 1..509
PgrDyPrx03 736 0 19..503 34..519
PgrDyPrx06 732 0 19..503 21..506
PgrDyPrx05 697 0 19..506 34..522
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16106..16160 55 N° 2 15222..15817 596 N° 3 14802..15096 295 N° 4 14589..14703 115
N° 5 14414..14502 89 N° 6 14198..14310 113 N° 7 13959..14081 123 N° 8 13811..13878 68
N° 9 13638..13713 76  
complement(join(13638..13713,13811..13878,13959..14081,14198..14310,14414..14502 ,14589..14703,14802..15096,15222..15817,16106..16160))


exon

Literature and cross-references PgrDyPrx08
DNA ref. JGI genome:   supercontig_2_40 (16160..13638)
Cluster/Prediction ref. JGI gene:   33463 [Incorrect prediction]
Protein sequence: PgrDyPrx08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   509 (488)
PWM (Da):   %s   55977.29 (53605.0)  
PI (pH):   %s   9.26 (9.09) Peptide Signal:   %s   cut: 22 range:22-509
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSNKLVWFLSLSVLRALVDLKNIQGDIIIGLQKRVEAFWFCTLKSESNSVEGFRRNLKDSLLPLITTTQDVLDTQKKINDHKRNKRSEGGNDLLPITQVNLGFSFAGLKKLGLKLEEIPTGGDGVFSKGQKVDAVDNLGDPVDPKTKKLKTWSKDFLHEANSIDFVILITAPDCKLLDQKLDQLRKNLSGFLASSFVRKGNVRPGNEVGHEHFGFDGISTPTIENINAQPGDKKSGIVKPDVVLLGQPASGGNTNNLDPKQAWIKDGSFMAFRELQQLVPEFQSFCDESAKKLQNPNVSGDFIGARIVGRWKSGAPLTLTPVQDKPELNRAQDFDYSDELKQERCPYAAHIRKTNPRNGIAGADPNTAVLPHLMIRNGIPGPELTEEEKKAKKTKENRGLLFVSYQSQIESGFQFVQLWCNNTDFPAKTPAKVTPGFDLLIGQTADEKPRVAQNINPLGIAGTTDPNNIVTAPAHFIVPLGGEYFLMPSIKAINEKLGLSSRSDL

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns). Incorrect prediction from JGI (fist and last introns are incorrect).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTAACAAGTTGGTCTGGTTTCTTTCTCTTTCTGTTCTCCGGGCCCTTGGTAGTTGCTGCTTCTCGCCAGTTTGTCTCGTATCAAACCTCTAGCTTTGCCAGCGATTTGTCTGG
GGTGAATGAACTACTTATGTGTTGGGCGGCGCTCGTATTAAGACTGTGTATAACTTATCGAGCTGGTATCGTCTACATATATGTAGTAGAACCCTATTTTCTTGATCTTTTGATGGCTCT
GCTTGCATCATGATTTGAAAAGCTCGAAGATAAACTAACTGACCGTTTGTTCTCTTCATACCCGTTCCGTTGACTTCCAACGTTACTCAACTGCTTTCCAGAGTTGACCTCAAGAACATC
CAAGGCGATATCATTATCGGTTTACAGAAACGAGTTGAAGCCTTCTGGTTTTGCACCCTAAAATCTGAATCCAACTCTGTCGAAGGTTTTCGTAGAAACCTGAAAGACTCTTTACTTCCG
TTGATTACCACCACTCAAGACGTACTCGACACACAAAAAAAGATCAATGATCATAAACGAAATAAGAGATCCGAGGGGGGGAACGACTTGTTACCCATCACCCAGGTCAACCTCGGATTC
AGCTTTGCCGGATTGAAAAAATTGGGACTTAAGCTCGAAGAGATCCCAACCGGTGGCGACGGAGTCTTCTCGAAGGGCCAAAAGGTTGATGCGGTCGATAACTTGGGCGACCCCGTCGAC
CCAAAGACGAAAAAGTTGAAGACCTGGTCTAAAGACTTTTTGCATGAAGCCAACTCGATCGATTTCGTCATCTTGATCACGGCTCCGGACTGCAAGTTGTTGGATCAAAAACTAGACCAG
CTTCGAAAGAATTTGAGCGGGTTTTTGGCCTCTTCGTTTGTTCGCAAGGGTAATGTTAGACCCGGTAATGAGGTCGGGCATGAGCACTTTGGGTTCTTA
GTTGAGTGTCTTTCCTGCTTT
TTTTACCCTCATGAGTTTTGATATTGTCCACAAGCGGCAAATTGAGTCAATCAACCAATTACCTATACTGATAATGAACAAACCAATCTTCAAAATTTCAAAAGGACGGGATTTCCACGC
CAACGATCGAAAATATTAATGCCCAACCAGGTGATAAGAAGAGTGGAATAGTTAAACCGGATGTGGTTTTACTCGGCCAACCTGCTTCGGGTGGGAATACCAATAACTTGGATCCCAAGC
AGGCTTGGATTAAAGATGGCTCGTTTATGGCTTTCAGAGAGCTCCAACAACTCGTACCAGAGTTTCAATCCTTCTGCGACGAGTCTGCCAAAAAGCTTCAAAACCCTAATGTGTCTGGCG
ACTTCATCGGGGCTAGAATTGTTGGCAGATGGAAATCAG
GTGAGAGCTTTCACTTGGTCTTTCCATTTTCAACTCAAGAAACACGATAAATGTTTAGCGCTTCTTATTGAATAACCTCCA
TCCTTGTCTTGTTTTAGGTGCCCCACTTACCTTGACCCCAGTCCAAGATAAACCGGAACTGAATCGAGCACAGGACTTCGATTATTCCGATGAATTGAAACAAGAACGTTGTCCCTACGC
TGCTCACATAAG
GTATCGGCTCAAATTTATGAACCAAAAGGATACCAAGTCCAATTGTAATTGAAATTATTATTATTATTATTTTTGCTGTCTCCTAGAAAAACTAACCCGCGTAATGGC
ATAGCTGGTGCGGATCCCAACACGGCCGTCTTGCCTCATCTTATGATCAGAAACGGCATCCCTTATG
GTAAGTCCTGGGACAGCTCTTGGAATTGCATTTATCTCCATGTTTGGATTTTA
ATTTCGCGTGGCCTGAAGAGGATTGACCATGGATGTGTTACATTCATTAGGGCCTGAGCTTACCGAGGAAGAAAAGAAAGCGAAGAAAACGAAAGAGAATCGTGGTCTATTATTTGTTTC
TTATCAAAGCCAAATCGAAAGTGGATTCCAATTTGTTCAGAAG
GTAACTAACCGTTCACTTAAGTCTCTCTTTGAATCTTGATTTTTTTTGAAAAGGACTGAGATCAGATGAAACTTCTG
ACTCTTTGTTGCCTCAATCGATTTTTTCGATCATCACAGCTTTGGTGCAACAACACCGATTTTCCGGCTAAAACTCCGGCTAAAGTGACTCCCGGGTTCGATTTGTTAATCGGACAAACC
GCTGATGAAAAGCCTCGAGTAGCTCAAAATATCAACCCATTG
GTGAGGACGATATCATAGTTCAATGGCTCAATGGAGGTTTGACAAATCGAGCCCTGTTTTGTGCATGTTTCGTTTGAC
AGGGAATTGCGGGCACTACCGATCCCAACAACATAGTGACCGCCCCGGCACATTTCATCGTTCCCCTTGGGTGAGTATCGGCTGCATTCTCAGAGAGTAGGAAATGAGACTAAACCTAAA
CATGACCTTTTACGTTACGTTATCCCATCTTTTAAATTCAACCCCAGTGGAGAATATTTCCTTATGCCTTCCATCAAAGCCATCAACGAAAAGCTTGGCCTTTCGTCAAGATCTGACCTA
TAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTAACAAGTTGGTCTGGTTTCTTTCTCTTTCTGTTCTCCGGGCCCTTGTTGACCTCAAGAACATCCAAGGCGATATCATTATCGGTTTACAGAAACGAGTTGAAGCCTTCTGG
TTTTGCACCCTAAAATCTGAATCCAACTCTGTCGAAGGTTTTCGTAGAAACCTGAAAGACTCTTTACTTCCGTTGATTACCACCACTCAAGACGTACTCGACACACAAAAAAAGATCAAT
GATCATAAACGAAATAAGAGATCCGAGGGGGGGAACGACTTGTTACCCATCACCCAGGTCAACCTCGGATTCAGCTTTGCCGGATTGAAAAAATTGGGACTTAAGCTCGAAGAGATCCCA
ACCGGTGGCGACGGAGTCTTCTCGAAGGGCCAAAAGGTTGATGCGGTCGATAACTTGGGCGACCCCGTCGACCCAAAGACGAAAAAGTTGAAGACCTGGTCTAAAGACTTTTTGCATGAA
GCCAACTCGATCGATTTCGTCATCTTGATCACGGCTCCGGACTGCAAGTTGTTGGATCAAAAACTAGACCAGCTTCGAAAGAATTTGAGCGGGTTTTTGGCCTCTTCGTTTGTTCGCAAG
GGTAATGTTAGACCCGGTAATGAGGTCGGGCATGAGCACTTTGGGTTCTTA
GACGGGATTTCCACGCCAACGATCGAAAATATTAATGCCCAACCAGGTGATAAGAAGAGTGGAATAGTT
AAACCGGATGTGGTTTTACTCGGCCAACCTGCTTCGGGTGGGAATACCAATAACTTGGATCCCAAGCAGGCTTGGATTAAAGATGGCTCGTTTATGGCTTTCAGAGAGCTCCAACAACTC
GTACCAGAGTTTCAATCCTTCTGCGACGAGTCTGCCAAAAAGCTTCAAAACCCTAATGTGTCTGGCGACTTCATCGGGGCTAGAATTGTTGGCAGATGGAAATCAG
GTGCCCCACTTACC
TTGACCCCAGTCCAAGATAAACCGGAACTGAATCGAGCACAGGACTTCGATTATTCCGATGAATTGAAACAAGAACGTTGTCCCTACGCTGCTCACATAAG
AAAAACTAACCCGCGTAAT
GGCATAGCTGGTGCGGATCCCAACACGGCCGTCTTGCCTCATCTTATGATCAGAAACGGCATCCCTTATG
GGCCTGAGCTTACCGAGGAAGAAAAGAAAGCGAAGAAAACGAAAGAGAAT
CGTGGTCTATTATTTGTTTCTTATCAAAGCCAAATCGAAAGTGGATTCCAATTTGTTCAGAAG
CTTTGGTGCAACAACACCGATTTTCCGGCTAAAACTCCGGCTAAAGTGACTCCCGGG
TTCGATTTGTTAATCGGACAAACCGCTGATGAAAAGCCTCGAGTAGCTCAAAATATCAACCCATTG
GGAATTGCGGGCACTACCGATCCCAACAACATAGTGACCGCCCCGGCACATTTC
ATCGTTCCCCTTGG
TGGAGAATATTTCCTTATGCCTTCCATCAAAGCCATCAACGAAAAGCTTGGCCTTTCGTCAAGATCTGACCTATAA

Retrieve as FASTA