Entry information : PplPrxII01-1B (PplPrxII01b)
Entry ID 10816
Creation 2012-04-06 (Catherine Mathe (Scipio))
Last sequence changes 2012-04-13 (Catherine Mathe (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-17 (Christophe Dunand)
Peroxidase information: PplPrxII01-1B (PplPrxII01b)
Name (synonym) PplPrxII01-1B (PplPrxII01b)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Postia
Organism Postia placenta    [TaxId: 104341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PplPrxII01-1B
start..stop
S start..stop
PplPrxII01-1A 339 1e-121 1..171 1..171
LbiPrxII 253 5e-88 4..171 2..169
SlutPrxII01 251 4e-87 5..171 6..172
SbrePrxII01 251 7e-87 5..171 6..172
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 306221..306320 100 N° 2 306382..306452 71 N° 3 306508..306654 147 N° 4 306708..306845 138
N° 5 306897..306956 60  
join(306221..306320,306382..306452,306508..306654,306708..306845,306897..306956)


exon

Literature and cross-references PplPrxII01-1B (PplPrxII01b)
DNA ref. JGI genome:   scaffold_52 (306221..306956)
EST ref. GenBank:   FL603251.1
Protein sequence: PplPrxII01-1B (PplPrxII01b)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   18139.42  
PI (pH):   %s   5.7
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPTVKVGDAVPEGTFAYIAYAPELDDHTACGIPTKLSTSEWKGKKVVLFSVPGAFPTCHVNHLPPYLEKYEEFKKKGVDVVAVVAANDAFVMSGWARVFGLKDKIVALSDSDAKWSKSLGLDKDLSAIGFGTRTDRYALVLDDLKIKYIGLEPGADVTVSGADAVLAAL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 9 ESTs (FL614143.1, FL614144.1, FL597855.1, FL629349.1, FL597856.1, FL615265.1, FL624512.1, FL624513.1)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCCCACTGTCAAGGTTGGCGACGCCGTCCCTGAGGGCACCTTTGCCTACATTGCCTACGCCCCAGAGCTCGACGATCACACCGCCTGTGGTATCCGTGAGTAGTCCATCCCACCG
ATTGTCCCGATCTGCTCGATAACATGGCGGTCCGTGTACAGCCACCAAGCTCTCCACGAGTGAATGGAAGGGAAAGAAGGTTGTCCTTTTCTCCGTTCCCGGAGCCTTCACGGTTGGCAT
ATTGTCTCTCACGCGCGGTGCCCGTAATACTGACCGGTCGTTGCTAGCCTACCTGCCACGTAAACCACCTGCCGCCATACCTCGAGAAGTACGAGGAGTTCAAGAAGAAGGGCGTTGATG
TCGTCGCTGTTGTCGCCGCGAACGACGCCTTCGTCATGAGCGGCTGGGCGCGCGTTTTCGGATTGAAGGACAAG
GTGAAGAGCATTGTGCCCATTTTTGTACGATCTGCTGATCTCTGGC
TAAATAGATCGTCGCGCTCTCTGATTCCGACGCGAAGTGGTCCAAGTCGCTCGGTCTTGACAAAGATCTCTCGGCCATTGGCTTCGGTACCCGCACCGACCGCTATGCCTTGGTCTTGGA
CGACCTTAAGATCAAGTACATTGGG
GTGCGTTTTCCCTCTTTGTTAAATACGCAAGATCACTGACTTTCTGTGCAGCTCGAGCCAGGAGCAGATGTTACGGTCTCCGGTGCAGATGCTGT
CTTGGCCGCTCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCCCACTGTCAAGGTTGGCGACGCCGTCCCTGAGGGCACCTTTGCCTACATTGCCTACGCCCCAGAGCTCGACGATCACACCGCCTGTGGTATCCCCACCAAGCTCTCCACGAGT
GAATGGAAGGGAAAGAAGGTTGTCCTTTTCTCCGTTCCCGGAGCCTTCACG
CCTACCTGCCACGTAAACCACCTGCCGCCATACCTCGAGAAGTACGAGGAGTTCAAGAAGAAGGGCGTT
GATGTCGTCGCTGTTGTCGCCGCGAACGACGCCTTCGTCATGAGCGGCTGGGCGCGCGTTTTCGGATTGAAGGACAAG
ATCGTCGCGCTCTCTGATTCCGACGCGAAGTGGTCCAAGTCG
CTCGGTCTTGACAAAGATCTCTCGGCCATTGGCTTCGGTACCCGCACCGACCGCTATGCCTTGGTCTTGGACGACCTTAAGATCAAGTACATTGGG
CTCGAGCCAGGAGCAGATGTTACG
GTCTCCGGTGCAGATGCTGTCTTGGCCGCTCTCTGA

Retrieve as FASTA