Entry information : Ppl2CysPrx01-1B (Ppl2CysPrx01b)
Entry ID 10819
Creation 2012-04-17 (Catherine Mathe (Scipio))
Last sequence changes 2012-04-17 (Catherine Mathe (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-17 (Christophe Dunand)
Peroxidase information: Ppl2CysPrx01-1B (Ppl2CysPrx01b)
Name (synonym) Ppl2CysPrx01-1B (Ppl2CysPrx01b)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Postia
Organism Postia placenta    [TaxId: 104341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ppl2CysPrx01-1B
start..stop
S start..stop
Ppl2CysPrx01-1A 434 4e-158 1..210 1..210
Ccin2CysPrx 350 5e-125 1..210 1..211
Athi2CysPrx01 350 1e-124 1..210 1..217
Pc2CysPrx01-1 344 1e-122 1..210 1..211
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 177055..177155 101 N° 2 176971..176994 24 N° 3 176839..176924 86 N° 4 176582..176780 199
N° 5 176446..176524 79 N° 6 176245..176388 144  
complement(join(176245..176388,176446..176524,176582..176780,176839..176924,1769 71..176994,177055..177155))


exon

Literature and cross-references Ppl2CysPrx01-1B (Ppl2CysPrx01b)
DNA ref. JGI genome:   scaffold_179 (177155..176245)
Protein sequence: Ppl2CysPrx01-1B (Ppl2CysPrx01b)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   210
PWM (Da):   %s   23107.82  
PI (pH):   %s   5.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVATVQKPAPGFKAPAVVDGLFQDISLSDYLGQWVVLFFYPLDFTFVCPTEILAFNDALPQFKQLNTTVSVSTDSHFSHFAWATQDRKQGGLGPDLKLPMIADKSMSISRDYGVLIEEEGIALRGLFLIDPKGTLRQITVNDLPVGRSVDETIRLVKAFQFDEHGEVCPANWTEGSQTIKTDPHGKLEYFSTAGGANGEQSRKRPRID*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGCCACTGTTCAAAAGCCCGCCCCCGGTTTCAAGGCCCCTGCTGTCGTGGATGGCCTCTTCCAGGACATCTCGTTGTCAGATTATCTCGGTCAATGGTGAGATCGACATAGCCAC
TCGTATTAATAGCCCTTTTGGCTCATGATTATATTTGTCAGGGTGGTTCTCTTCTTCTACCCTCTGTGCGTATTCCCAGGACTGCCAAAACGCGTAACTGACCTGCCCCAGCGATTTCAC
GTTTGTGTGCCCGACCGAGATTCTTGCGTTCAATGATGCTTTGCCCCAATTCAAGCAGCTGAACACCACCGTCCTCA
GTATGGCATCTTTTTAGACTCGGAACAGGCACACCTCATCGCT
GGTCTGGTCATGCAGGTGTCTCGACGGACTCGCACTTTTCCCACTTCGCGTGGGCGACGCAGGACCGCAAGCAGGGTGGTCTCGGTCCCGACCTCAAGCTGCCCATGATCGCGGACAAGA
GCATGTCGATCTCCCGTGACTACGGCGTTCTCATCGAGGAGGAGGGCATTGCTCTCCGCGGCCTGTTCCTCATCGACCCCAAGGGCACGCTCAG
GTGTGTAAAACCATGAGCTGGCAATA
TGTGGCGTCGGCGCTCATATCTATGGCCTAGGCAAATCACCGTCAACGACCTGCCTGTTGGCCGCTCTGTCGACGAGACCATCCGTCTCGTCAAGGCCTTCCAATTCACCGTGCGTTCCT
CTGGCTTGGCACTGTCCTTGCTGTCGACACTGACTGAACACTTGCAGGACGAGCACGGTGAAGTGTGCCCTGCCAACTGGACTGAGGGTAGCCAGACGATCAAGACGGACCCTCACGGCA
AGCTGGAGTACTTCAGCACCGCTGGTGGCGCAAATGGCGAGCAATCCCGCAAGCGTCCACGTATAGACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGCCACTGTTCAAAAGCCCGCCCCCGGTTTCAAGGCCCCTGCTGTCGTGGATGGCCTCTTCCAGGACATCTCGTTGTCAGATTATCTCGGTCAATGGGTGGTTCTCTTCTTCTAC
CCTCT
CGATTTCACGTTTGTGTGCCCGACCGAGATTCTTGCGTTCAATGATGCTTTGCCCCAATTCAAGCAGCTGAACACCACCGTCCTCAGTGTCTCGACGGACTCGCACTTTTCCCAC
TTCGCGTGGGCGACGCAGGACCGCAAGCAGGGTGGTCTCGGTCCCGACCTCAAGCTGCCCATGATCGCGGACAAGAGCATGTCGATCTCCCGTGACTACGGCGTTCTCATCGAGGAGGAG
GGCATTGCTCTCCGCGGCCTGTTCCTCATCGACCCCAAGGGCACGCTCAG
GCAAATCACCGTCAACGACCTGCCTGTTGGCCGCTCTGTCGACGAGACCATCCGTCTCGTCAAGGCCTTC
CAATTCACC
GACGAGCACGGTGAAGTGTGCCCTGCCAACTGGACTGAGGGTAGCCAGACGATCAAGACGGACCCTCACGGCAAGCTGGAGTACTTCAGCACCGCTGGTGGCGCAAATGGC
GAGCAATCCCGCAAGCGTCCACGTATAGACTGA

Retrieve as FASTA