Entry information : OsPrx72
Entry ID 1082
Creation 2006-07-25 (Filippo Passardi)
Last sequence changes 2006-07-25 (Filippo Passardi)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-29 (Qiang Li)
Peroxidase information: OsPrx72
Name OsPrx72
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Callus
Leaves
Roots
Inducers Fungus infection
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx72
start..stop
S start..stop
SbPrx116 500 2e-179 8..354 17..363
SiPrx45 498 1e-178 4..329 10..330
BdiPrx74 497 1e-178 3..335 11..338
ZmPrx03_Du101 491 8e-176 9..331 16..340
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3587420..3587617 198 N° 2 3586717..3587157 441 N° 3 3585802..3586227 426  
complement(join(3585802..3586227,3586717..3587157,3587420..3587617))


exon

Literature and cross-references OsPrx72
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1M1
DNA ref. GenBank:   NC_008398.1 (3587617..3585805)
Protein sequence: OsPrx72
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   354 (335)
PWM (Da):   %s   37240.56 (35476.5)  
PI (pH):   %s   5.63 (5.11) Peptide Signal:   %s   cut: 20 range:20-354
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLAVVAALISAAAVGARACLDVGFYDTTCPTAETLIQQVVAAAFRNDSGVAPAMIRMHFHDCFVRGCDGSVLIDTVPGSTTRAEKDAAPNNPSLRFFDVIDRAKSAVEAACPGVVSCADVVAFMARDGVVLSGGLGYQVPAGRRDGRTSLEDDALNFLPPPTSTAADLVANFTAKNLTAEDMVVLSGAHTIGVSHCDSFTNRIYNFPNTTDGIDPSLSKAYAFLLKGICPPNSNQTFPTTTTFMDILTPTKFDNRYYVGLTNNLGLFQSDAALLTDAALKATVNSFVRSEATFRLKFARAMIKMGQIGVLSGTQGEIRLNCRVVNPVNVTATAADDHHLTSSSSSSSDEVAAS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, introns 1 and 3') and 8 ESTs. Containing IntR (3').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCGCCGTGGTGGCCGCGCTCATCTCGGCCGCCGCCGTGGGCGCCCGCGCCTGCCTCGACGTCGGCTTCTACGACACGACGTGCCCGACGGCGGAGACGCTCATACAGCAGGTC
GTCGCCGCCGCCTTCCGCAACGACTCCGGCGTCGCGCCGGCCATGATCCGCATGCATTTCCACGACTGCTTCGTCAGG
GTAAGTACTAAAGCACCATTATTAGAGAAATCATTTTTTGTT
CGTTACTCAAAATCTACAATAATCTTGGTTTAAATAGGAACCGGTCTAAGTTAAAACACCATACGGCACTTTTTAAAACGAAAGATTATTTTTAATCCCGATTTAAAAGAAGGCAAGCTA
TGTCAGACCCCTCCACTCTTCTTTTGCTTCATGGATTTATGTGCCAAGTGCCAACTCATCGTCGTCTTCGTCCATGGCGGCGCGGTGATGATGCGTGCAGGGCTGCGACGGCTCGGTGCT
GATCGACACCGTGCCGGGGTCGACGACGAGGGCGGAGAAGGACGCCGCGCCAAACAACCCGAGCCTCCGGTTCTTCGACGTGATCGACCGCGCCAAGTCGGCCGTCGAGGCGGCGTGCCC
GGGCGTCGTCTCCTGCGCCGACGTCGTCGCCTTCATGGCGCGGGACGGCGTCGTGCTGTCCGGCGGCCTCGGCTACCAGGTGCCCGCGGGGCGGCGCGACGGCCGGACCTCCCTCGAGGA
CGACGCGCTCAACTTCCTGCCGCCGCCAACGTCCACCGCCGCCGACCTCGTCGCCAACTTCACCGCCAAGAACCTCACCGCCGAGGACATGGTCGTCCTCTCCGGCGCCCACACCATCGG
CGTCTCCCACTGCGACTCCTTCACCAATCGCATCTACAACTTCCCCAACACAACCGATGGA
GTAAAATCTTCTTTAACCAACAACTCATCAAAGAAATGAAAAAACTGAAGAACATATGC
AGAAGTGGATTTTCGTCCCTTTGGTGACATCCTCTCATTTTGTGCATGTCGTTTAAAAAATTATAAAAAAATTTAAAAAATTTGTGAAGATAGATCAATATGTGATATATCTTTTTACAA
ATATACGAGTTAAAATTCAATTTATACAATTTAAAATAAAAATAATAAATTTGACCATGAATTACACGTTCAATTCATAGTCAAATTTGTTATTTTTGTTTCTATTTGTATAAATTGAAT
TTGAATTTGCATGTTTATGAAGTGACATATCACATATTAATCAATCCTACTAAATTTTTTAAATTTTTTTGATGACTTTTAAGTGACATGTAAAAAATGAGAGAGGATATCCCCTTACGG
GATGTTTTGAGTTTTCCAGCATTTGAGTTCATCATTAGTCGTCTGACCTGTGTGATTATTTCGTGCGCAGATTGATCCGTCGTTGAGCAAGGCGTACGCGTTCTTGCTGAAGGGCATCTG
TCCGCCGAACAGCAACCAGACGTTCCCGACGACGACCACCTTCATGGACATCCTGACGCCGACCAAGTTCGACAACAGGTACTACGTCGGGCTGACAAACAACCTCGGCCTCTTCCAGTC
GGACGCGGCGCTGCTGACGGACGCCGCGCTCAAGGCCACGGTGAACTCCTTCGTGCGCAGCGAGGCGACGTTCCGGCTCAAGTTCGCCAGGGCCATGATCAAGATGGGGCAGATCGGCGT
GCTGTCCGGGACGCAGGGCGAGATCAGGCTCAACTGCAGGGTCGTCAACCCTGTCAATGTCACTGCTACTGCAGCTGATGATCACCACCTTACTTCCTCTTCCTCCTCTTCTTCAGATGA
AGTGGCTGCAAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCGCCGTGGTGGCCGCGCTCATCTCGGCCGCCGCCGTGGGCGCCCGCGCCTGCCTCGACGTCGGCTTCTACGACACGACGTGCCCGACGGCGGAGACGCTCATACAGCAGGTC
GTCGCCGCCGCCTTCCGCAACGACTCCGGCGTCGCGCCGGCCATGATCCGCATGCATTTCCACGACTGCTTCGTCAGG
GGCTGCGACGGCTCGGTGCTGATCGACACCGTGCCGGGGTCG
ACGACGAGGGCGGAGAAGGACGCCGCGCCAAACAACCCGAGCCTCCGGTTCTTCGACGTGATCGACCGCGCCAAGTCGGCCGTCGAGGCGGCGTGCCCGGGCGTCGTCTCCTGCGCCGAC
GTCGTCGCCTTCATGGCGCGGGACGGCGTCGTGCTGTCCGGCGGCCTCGGCTACCAGGTGCCCGCGGGGCGGCGCGACGGCCGGACCTCCCTCGAGGACGACGCGCTCAACTTCCTGCCG
CCGCCAACGTCCACCGCCGCCGACCTCGTCGCCAACTTCACCGCCAAGAACCTCACCGCCGAGGACATGGTCGTCCTCTCCGGCGCCCACACCATCGGCGTCTCCCACTGCGACTCCTTC
ACCAATCGCATCTACAACTTCCCCAACACAACCGATGGA
ATTGATCCGTCGTTGAGCAAGGCGTACGCGTTCTTGCTGAAGGGCATCTGTCCGCCGAACAGCAACCAGACGTTCCCGACG
ACGACCACCTTCATGGACATCCTGACGCCGACCAAGTTCGACAACAGGTACTACGTCGGGCTGACAAACAACCTCGGCCTCTTCCAGTCGGACGCGGCGCTGCTGACGGACGCCGCGCTC
AAGGCCACGGTGAACTCCTTCGTGCGCAGCGAGGCGACGTTCCGGCTCAAGTTCGCCAGGGCCATGATCAAGATGGGGCAGATCGGCGTGCTGTCCGGGACGCAGGGCGAGATCAGGCTC
AACTGCAGGGTCGTCAACCCTGTCAATGTCACTGCTACTGCAGCTGATGATCACCACCTTACTTCCTCTTCCTCCTCTTCTTCAGATGAAGTGGCTGCAAGCTAA

Retrieve as FASTA