Entry information : PplCcP01-1B (PplCcP01b)
Entry ID 10820
Creation 2012-04-17 (Catherine Mathe (Scipio))
Last sequence changes 2012-04-17 (Catherine Mathe (Scipio))
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2012-04-17 (Christophe Dunand)
Peroxidase information: PplCcP01-1B (PplCcP01b)
Name (synonym) PplCcP01-1B (PplCcP01b)
Class Cytochrome C peroxidase     [Orthogroup: CcP001]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Postia
Organism Postia placenta    [TaxId: 104341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PplCcP01-1B
start..stop
S start..stop
PplCcP01-1A 281 8e-97 1..132 242..373
TcamCcP 250 1e-84 1..132 241..372
LsulCcP01 249 4e-84 1..132 242..373
WcoCcP 246 9e-83 1..132 241..372
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 716989..717287 299 N° 2 717346..717445 100  
join(716989..717287,717346..717445)


exon

Literature and cross-references PplCcP01-1B (PplCcP01b)
DNA ref. JGI genome:   scaffold_9 (716989..717445)
Protein sequence: PplCcP01-1B (PplCcP01b)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   132
PWM (Da):   %s   15298.55  
PI (pH):   %s   5.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
FNDQEIVALSGAHALGRCHRDRSGFEGPWTFSPVTVSNEYYRLLLEEKWVWRKWDGPKQLQDKTTRSLMMLPSDYALTQDKAFRKWVEAYAKDQDVWFKDFSNVISHLFELGVPEAQFVASEGWIMKGTDEQ

Retrieve as FASTA  
Remarks Incomplte: gap to querystart,
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCAATGACCAGGAGATCGTCGCACTGTCTGGCGCGCACGCGCTTGGGCGGTGCCATCGTGACCGCTCCGGCTTCGAGGGTCCCTGGACGTTCTCCCCCGTGACAGTCAGCAACGAGTAT
TACCGCCTCCTGCTCGAGGAAAAGTGGGTCTGGCGCAAGTGGGACGGACCGAAGCAGCTCCAGGACAAGACGACACGCTCGCTCATGATGCTCCCGTCGGACTACGCGCTCACCCAGGAC
AAGGCATTCCGCAAGTGGGTCGAGGCGTACGCCAAGGACCAGGACGTGTGGTTCAAGGA
GTGCGTTGACCCCCGTCTCTTTTGGTCCTTCTACTGACCGATGCGTGCGGCATAATAGCTT
CTCTAACGTGATTTCTCACCTGTTCGAGCTTGGCGTTCCCGAGGCGCAGTTCGTTGCCTCGGAGGGGTGGATTATGAAGGGCACCGACGAGCAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCAATGACCAGGAGATCGTCGCACTGTCTGGCGCGCACGCGCTTGGGCGGTGCCATCGTGACCGCTCCGGCTTCGAGGGTCCCTGGACGTTCTCCCCCGTGACAGTCAGCAACGAGTAT
TACCGCCTCCTGCTCGAGGAAAAGTGGGTCTGGCGCAAGTGGGACGGACCGAAGCAGCTCCAGGACAAGACGACACGCTCGCTCATGATGCTCCCGTCGGACTACGCGCTCACCCAGGAC
AAGGCATTCCGCAAGTGGGTCGAGGCGTACGCCAAGGACCAGGACGTGTGGTTCAAGGA
CTTCTCTAACGTGATTTCTCACCTGTTCGAGCTTGGCGTTCCCGAGGCGCAGTTCGTTGCC
TCGGAGGGGTGGATTATGAAGGGCACCGACGAGCAGTAG

Retrieve as FASTA