Entry information : AacuGPx02
Entry ID 10821
Creation 2012-04-23 (Catherine Mathe (Scipio))
Last sequence changes 2014-11-26 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-11-26 (Christophe Dunand)
Peroxidase information: AacuGPx02
Name AacuGPx02
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Aspergillus
Organism Aspergillus aculeatus    [TaxId: 5053 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AacuGPx02
start..stop
S start..stop
AcarGPx01 327 8e-115 1..183 74..249
AnGPx 323 5e-113 1..183 85..260
PEchGPx01 315 2e-111 1..183 1..176
AfumGPx 311 4e-109 1..194 45..231
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2691623..2691685 63 N° 2 2690924..2691511 588  
complement(join(2690924..2691511,2691623..2691685))


exon

Literature and cross-references AacuGPx02
DNA ref. JGI genome:   scaffold_1 (2691685..2690924)
Protein sequence: AacuGPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   216
PWM (Da):   %s   23260.61  
PI (pH):   %s   4.78
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSATTFYDFEPVDSTSCTFPEKGNPFPLTDVKGKVVLVVNTASKCGFTPQFKGLETLYQELKAQYPEDFTILGFPCNQFGSQDPGSNDEIQSFCQLNYGVTFPVLGKLDVNGDKAHPVWTWMKQEQPGLLGMKRIKWNFEKFLISADGKVVGRWASLTKPESLKDTIVQEIEKARKEGKLASQTTGAAAPAAEEAPTATAAAAAPTPAEGAEANL*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCGCTACCACTTTCTACGACTTCGAGCCCGTCGATAGTACGTCCTGCACCTTTCCTTTTCCCCTTTCCCCGCTCATCTACCGCTCCACATACCAAGAAAAAAAAAAAAAGCAA
AAGCTTCCCAAATTTCCTCTTTGCTTCCACTAATTCATTCTTCTGATCCAAACAGAGAAGGGCAACCCCTTCCCCCTCACCGACGTGAAGGGCAAAGTCGTCCTCGTCGTCAACACCGCC
TCGAAGTGCGGCTTCACCCCGCAGTTCAAGGGGCTCGAGACCCTCTACCAGGAGCTCAAGGCCCAGTACCCGGAGGACTTCACCATCCTGGGCTTCCCCTGCAATCAGTTCGGCAGCCAG
GACCCCGGGTCCAACGATGAGATCCAGTCCTTCTGTCAGCTCAACTACGGCGTCACCTTCCCGGTGCTGGGTAAGCTCGACGTCAACGGCGATAAGGCCCACCCCGTGTGGACCTGGATG
AAGCAGGAGCAGCCGGGTCTACTGGGCATGAAGCGCATCAAGTGGAACTTCGAGAAGTTCCTGATCTCTGCCGACGGCAAGGTGGTCGGCCGCTGGGCCAGTCTGACCAAGCCCGAGTCG
CTCAAGGACACCATCGTCCAGGAGATCGAGAAGGCGCGGAAGGAGGGCAAGCTGGCCTCCCAGACCACGGGTGCTGCTGCTCCTGCTGCTGAGGAAGCTCCTACTGCTACGGCGGCGGCT
GCCGCGCCTACTCCTGCTGAGGGTGCTGAGGCCAACCTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCGCTACCACTTTCTACGACTTCGAGCCCGTCGATAGTACGTCCTGCACCTTTCCTGAGAAGGGCAACCCCTTCCCCCTCACCGACGTGAAGGGCAAAGTCGTCCTCGTCGTC
AACACCGCCTCGAAGTGCGGCTTCACCCCGCAGTTCAAGGGGCTCGAGACCCTCTACCAGGAGCTCAAGGCCCAGTACCCGGAGGACTTCACCATCCTGGGCTTCCCCTGCAATCAGTTC
GGCAGCCAGGACCCCGGGTCCAACGATGAGATCCAGTCCTTCTGTCAGCTCAACTACGGCGTCACCTTCCCGGTGCTGGGTAAGCTCGACGTCAACGGCGATAAGGCCCACCCCGTGTGG
ACCTGGATGAAGCAGGAGCAGCCGGGTCTACTGGGCATGAAGCGCATCAAGTGGAACTTCGAGAAGTTCCTGATCTCTGCCGACGGCAAGGTGGTCGGCCGCTGGGCCAGTCTGACCAAG
CCCGAGTCGCTCAAGGACACCATCGTCCAGGAGATCGAGAAGGCGCGGAAGGAGGGCAAGCTGGCCTCCCAGACCACGGGTGCTGCTGCTCCTGCTGCTGAGGAAGCTCCTACTGCTACG
GCGGCGGCTGCCGCGCCTACTCCTGCTGAGGGTGCTGAGGCCAACCTCTAA

Retrieve as FASTA