Entry information : EglPrx02
Entry ID 10825
Creation 2012-05-02 (Qiang Li)
Last sequence changes 2014-03-26 (Christophe Dunand)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2014-03-26 (Christophe Dunand)
Peroxidase information: EglPrx02
Name EglPrx02
Class Class III peroxidase     [Orthogroup: Prx046]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx02
start..stop
S start..stop
EgrPrx02 601 0 1..311 3..330
EcamPrx15 601 0 1..311 7..334
EguPrx02 597 0 1..311 3..330
EgrPrx15 597 0 1..311 7..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..228 228 N° 2 423..557 135 N° 3 754..913 160 N° 4 1169..1581 413
join(1..228,423..557,754..913,1169..1581)


exon

Literature and cross-references EglPrx02
Protein sequence: EglPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   311 (295)
PWM (Da):   %s   34005.36 (32238.4)  
PI (pH):   %s   7.98 (7.76) Peptide Signal:   %s   cut: 17 range:17-311
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
WQLLLSALALLRSCQAQPIEAKATIKLxxxxxWHFYQNSCPDVEKYVRDQVEFYWKQDSTLAPKLIQLLYTDCFIKGCDASVLLDGPDAEKTAPQNAAILGFPLEVIDKVKEVLEQHCPGVAGGVSYPVPTGRRDGNSSNAKLVDLPKRAVPWEKVIPYFKIRGLDLFDVTTLLGGHTLGRTSCEFIAERLYEFNNTGKPDPSMDPSFLAELRVQCPPNSTNSVYLNxxSGSSNRFSKTFYSRVLNHRAVLSIDQQIAAHKESLQIARRYDANFEDFLKMFGYSMTKLGNTWLLPGDQGEIRKNCRVVNGK

Retrieve as FASTA  
Remarks Partial sequence from NGS. Start codon and SCADIL are missing due to NNNN. Containing motif YTDC instead of FHDC.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCAGCTGTTGCTATCGGCGCTCGCGTTGTTGCGCTCGTGCCAGGCACAGCCCATCGAGGCCAAGGCTACGATCAAGCTGNNNNNNNNNNNNNNGTGGCATTTCTACCAGAACTCGTGC
CCCGACGTCGAGAAGTACGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGCACCCTCGCTCCCAAGCTCATCCAACTTCTCTACACTGACTGCTTCATCAAG
GCACGTACCGTC
TGTTCATTTNNNNNNNNNNNNNNNNNNNNNGATCTTGAAGTCGGCATCACTTTAATCATCGAGTTTCCGTTGCCCTATCTAAGCATGCCAAATCCTTTCACCCGTTNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGTACGTATGTATGGTTATGTGGATAAAACAGGGATGCGATGCGTCGGTTCTCTTGGACGGGCCAGATGCAGAGAAAACAGCACCACAAA
ATGCAGCGATTCTAGGGTTTCCTCTGGAGGTGATTGACAAGGTCAAGGAAGTCCTGGAACAGCATTGTCCCGGGGTC
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAAGAGATTGTTTGGGCTGCTGCACTGATGATAATCGACGTGCTGTTAGCTTGAGTTTTGAAGCGTTCGATATGGAAAGGAAAAAAATT
AGAATTACTAATGTGATAATGATGTTGTAATAGGCTGGAGGGGTGTCGTACCCTGTTCCGACGGGGAGGAGGGACGGAAATTCGTCCAATGCGAAGTTGGTGGACCTCCCAAAGCGCGCC
GTCCCGTGGGAAAAGGTGATCCCTTACTTCAAAATAAGGGGCTTGGATTTGTTCGACGTCACTACTCTACTTG
GTACGGTCTAACCCTCGAATGAAAAGTGTTTATTTGACTCCGACCTC
GTTACATTACCTTAAGATCTTAACCAATCCAGGCAACTCATTTAGTTCAGTGAATCACGCTGTCCCTTCTAGCTTTCATGTAATCCGAACCAATCCTCCCAATGATCTCCTCCAAGTGCA
CAAAAATGGCATGCTCACGTATCATGTCAAACTCTCAATCATAACCAATTCCTCCTAACTTTTCCAAAAACAACTTAAATTTTGCCAGGGGGGCATACACTGGGCAGGACCAGCTGCGAG
TTCATCGCAGAAAGACTGTACGAGTTCAACAACACTGGCAAGCCAGACCCAAGCATGGACCCATCCTTCTTGGCCGAATTGAGGGTGCAATGCCCGCCAAACTCAACGAATTCAGTGTAC
CTAAACNNNNNCTCAGGCTCGAGTAACAGGTTCAGCAAAACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTCAGCATCGACCAGCAGATCGCCGCCCATAAGGAGAGCCTCCAG
ATTGCCCGGCGGTACGATGCCAATTTTGAGGACTTCCTGAAGATGTTCGGCTATTCAATGACCAAGCTGGGGAACACCTGGCTCCTACCAGGGGATCAGGGTGAGATTCGCAAGAATTGC
CGAGTCGTGAATGGGAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCAGCTGTTGCTATCGGCGCTCGCGTTGTTGCGCTCGTGCCAGGCACAGCCCATCGAGGCCAAGGCTACGATCAAGCTGNNNNNNNNNNNNNNGTGGCATTTCTACCAGAACTCGTGC
CCCGACGTCGAGAAGTACGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGCACCCTCGCTCCCAAGCTCATCCAACTTCTCTACACTGACTGCTTCATCAAG
GGATGCGATGCG
TCGGTTCTCTTGGACGGGCCAGATGCAGAGAAAACAGCACCACAAAATGCAGCGATTCTAGGGTTTCCTCTGGAGGTGATTGACAAGGTCAAGGAAGTCCTGGAACAGCATTGTCCCGGG
GTC
GCTGGAGGGGTGTCGTACCCTGTTCCGACGGGGAGGAGGGACGGAAATTCGTCCAATGCGAAGTTGGTGGACCTCCCAAAGCGCGCCGTCCCGTGGGAAAAGGTGATCCCTTACTTC
AAAATAAGGGGCTTGGATTTGTTCGACGTCACTACTCTACTTG
GGGGGCATACACTGGGCAGGACCAGCTGCGAGTTCATCGCAGAAAGACTGTACGAGTTCAACAACACTGGCAAGCCA
GACCCAAGCATGGACCCATCCTTCTTGGCCGAATTGAGGGTGCAATGCCCGCCAAACTCAACGAATTCAGTGTACCTAAACNNNNNCTCAGGCTCGAGTAACAGGTTCAGCAAAACCTTC
TACTCCAGGGTCCTGAACCACCGGGCCGTCCTCAGCATCGACCAGCAGATCGCCGCCCATAAGGAGAGCCTCCAGATTGCCCGGCGGTACGATGCCAATTTTGAGGACTTCCTGAAGATG
TTCGGCTATTCAATGACCAAGCTGGGGAACACCTGGCTCCTACCAGGGGATCAGGGTGAGATTCGCAAGAATTGCCGAGTCGTGAATGGGAAATAA

Retrieve as FASTA