Entry information : EglPrx04
Entry ID 10827
Creation 2012-05-02 (Qiang Li)
Last sequence changes 2014-03-26 (Christophe Dunand)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2014-03-26 (Christophe Dunand)
Peroxidase information: EglPrx04
Name EglPrx04
Class Class III peroxidase     [Orthogroup: Prx046]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx04
start..stop
S start..stop
EguPrx04 502 0 8..251 83..333
EgrPrx04 502 0 8..251 83..333
EcamPrx04 500 0 8..251 79..329
EgrPrx13 499 0 8..251 83..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..87 87 N° 2 446..610 165 N° 3 766..925 160 N° 4 1220..1626 407
join(1..87,446..610,766..925,1220..1626)


exon

Literature and cross-references EglPrx04
Protein sequence: EglPrx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   251
PWM (Da):   %s   27683.84  
PI (pH):   %s   6.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
WRFEAExGCDASILLDGPDTEKTAPQNAPILGFPLEVIDKVKEVLEQHCPGVVSCADIINLAAGGVSYPVPTGRRDGNSSSAKLVDIAVHATPWEKVIHYFEVRGMNVFDVTTLLGGHTLGRTRCKFIAERLYDFNNTGKPDQSMDPSFLAELRVQCPPNSTNSVYLNPDSGSSNRFGKTFYSRVLNHRAVLSIDQQIADREESLQIARRYDANFEDFLKMFGYAMTKLGNTWLLPGDQGEIRKNCRVVNR

Retrieve as FASTA  
Remarks Partial sequence from NGS. Exon 1 missing due to NNNN.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGCTTTGAGGCCGAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCCTCTCTCTCTCTCTCTCTCAAACGATCTCAAAGTCAG
CATCGCTTCGATCATCGAGTTTCTGTCGCCCCTTCTGAGCATGCCATATACTTTCACCCAATGGTTTAACCTCTCGGACTCGTCTTTCTAGCATACCAATCTTTTCTGAACATATGTATG
GTTTATGTGGATAAAAAAGGGATGCGATGCGTCGATTCTCTTGGACGGGCCAGACACAGAGAAAACAGCACCACAAAATGCACCGATCCTAGGTTTTCCTCTTGAGGTGATTGACAAGGT
CAAGGAAGTTCTGGAACAGCACTGTCCCGGGGTTGTCTCTTGCGCCGACATTATCAACCTTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGGTTCTCAGTTTTTCCTTTTTGGG
CTGGAAAAGA
GATATGCTGTTAGCTTGAGTTTTGGAGCGTTCGATATGGACAGAAAAAAAAAAATCAGAATTNNNNNNNNNNNNNNNNNNNTGTAATAGGCGGGAGGAGTGTCGTACCCC
GTTCCGACGGGGAGGAGGGACGGAAATTCGTCCAGTGCGAAGTTGGTGGACATCGCAGTGCACGCCACCCCGTGGGAAAAGGTGATCCATTACTTCGAAGTAAGGGGCATGAATGTGTTC
GACGTCACTACTCTACTTGGTACGGTCTAACTCTCGAATGAAAAGTGTTTATTTGACTCCGACCTCATTACATTACCTTAAGATC
TTAACCAATTCAGGCAACTCATTTAATTCAGTGAA
TCAAGCTGTCCATTTAGCTTTCGCTAAGTCGAAGAATTTTATCAGATATAGAATCGTCGAGGATGTAATCCGAACCAATCCTCATAATGATCTCCCCCAAGTGCACAAAAATGGCATGCT
CACGTAATATATCAATCTCTCAATCATAACCAATTCCTCCTTACTTTGCCAAAAACAATTTAAATTTTGCCAGGGGGCCATACACTGGGCAGGACTAGATGCAAGTTCATCGCAGAAAGA
CTGTATGATTTCAACAACACTGGCAAGCCAGACCAAAGCATGGACCCATCCTTCTTGGCCGAATTGAGGGTGCAATGCCCGCCCAACTCAACGAATTCAGTGTACCTTAACCCTGACTCA
GGCTCGAGTAACAGGTTCGGCAAAACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTCAGCATCGACCAGCAGATCGCCGACCGTGAGGAGAGCCTCCAGATTGCCCGGCGGTAC
GATGCCAATTTTGAGGACTTCCTGAAGATGTTCGGCTATGCTATGACCAAGCTGGGGAACACCTGGCTCCTGCCAGGGGATCAGGGTGAGATTCGCAAGAATTGCCGAGTCGTGAACAGG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGCTTTGAGGCCGAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATCCTAGGTTTTCCTCTTGAGGTGATTGACAAG
GTCAAGGAAGTTCTGGAACAGCACTGTCCCGGGGTTGTCTCTTGCGCCGACATTATCAACCTTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGGTTCTCAGTTTTTCCTTTTTG
GGCTGGAAAAGA
GTGGACATCGCAGTGCACGCCACCCCGTGGGAAAAGGTGATCCATTACTTCGAAGTAAGGGGCATGAATGTGTTCGACGTCACTACTCTACTTGGTACGGTCTAACTC
TCGAATGAAAAGTGTTTATTTGACTCCGACCTCATTACATTACCTTAAGATC
CTGGCAAGCCAGACCAAAGCATGGACCCATCCTTCTTGGCCGAATTGAGGGTGCAATGCCCGCCCAAC
TCAACGAATTCAGTGTACCTTAACCCTGACTCAGGCTCGAGTAACAGGTTCGGCAAAACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTCAGCATCGACCAGCAGATCGCCGAC
CGTGAGGAGAGCCTCCAGATTGCCCGGCGGTACGATGCCAATTTTGAGGACTTCCTGAAGATGTTCGGCTATGCTATGACCAAGCTGGGGAACACCTGGCTCCTGCCAGGGGATCAGGGT
GAGATTCGCAAGAATTGCCGAGTCGTGAACAGG

Retrieve as FASTA